spacer

EBI Dbfetch

ID   AK048819; SV 1; linear; mRNA; HTC; MUS; 4111 BP.
XX
AC   AK048819;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus 0 day neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:C230073A08 product:K+ voltage-gated channel, subfamily S, 2,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4111
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1f0b58e175b1f435850435d408a8ac22.
DR   Ensembl-Gn; ENSMUSG00000050963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072868; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C230073A08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4111
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C230073A08"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             516..1949
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="K+ voltage-gated channel, subfamily S, 2
FT                   (MGD|MGI:1197011 GB|NM_008436, evidence: BLASTN, 99%,
FT                   match=2142)"
FT                   /note="putative"
FT                   /db_xref="GOA:O35174"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003971"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1197011"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35174"
FT                   /protein_id="BAC33468.1"
FT                   /translation="MTRQSLWDVSDTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGR
FT                   LLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQE
FT                   IEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDG
FT                   QPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPG
FT                   EDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVV
FT                   ESSPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGI
FT                   SIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGI
FT                   LVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMAS
FT                   LTNMSRSSPSELSLDDSLH"
XX
SQ   Sequence 4111 BP; 956 A; 984 C; 1055 G; 1116 T; 0 other;
     atgatgctcc ggaacgtctc aagagtctgg gcggcgactg tgccccgggc tggcgcgctc        60
     ggagctgtcc gttcagcacc accgcgcagc accaggctca aggccctctg caaggcgcac       120
     cggctcggtt cccgcccccg ctccacgggc gcctgcggcg tgggctcctg cctctcgtgg       180
     tgggtgaggg gcgcgcagat cggaagaggg gggctccacg agcgtcgggg ccacgcagcc       240
     acctgtgagc ctctcgcgga tgtgggcggt ggtgtgtgcg gccggagact gaaggaggcg       300
     cacggtggac cccgcctgcc cggtggcggg gcacacagac aagcactcac atctacatcc       360
     tcgcacccgc gcgcactcgc gcagccagcc aacggcgtcc accgcggtga tgcttgccag       420
     caggtcgggg aagtttcccg ccggcctctg ccgcgggctc ccgtgcaccc aggcgtagcg       480
     cccccgcgcg gcgcgggcgc ctgggcatct ccagcatgac ccgccagagc ctgtgggatg       540
     tgtccgatac cgacgtagag gatggagaga tccgcatcaa tgtgggtggc ttcaagagac       600
     ggctgcgttc ccatacgctg ctgcgcttcc ctgagacacg cctgggccgt ctgctcctct       660
     gccactcgcg agaggccatt ctggaactct gcgatgacta cgatgacgtt cagcgtgagt       720
     tctacttcga ccgtaacccc gagctcttcc cctatgtgtt gcatttctac cacaccggca       780
     agcttcacgt catggctgag ctgtgcgtct tctccttcag ccaggagatc gagtactggg       840
     gtatcaatga gttcttcatc gactcttgct gcagctatag ctatcacggc cgcaaagtgg       900
     aacctgagca ggagaaatgg gacgagcaga gtgaccagga aagcaccact tcctccttcg       960
     atgagatctt ggccttctat aatgatgctt ccaagttcga tgggcaaccc ctgggcaact      1020
     tccgcaggca gctgtggctg gcgttggaca acccaggcta ctcagtccta agcagggtct      1080
     tcagtgtcct ttccatcttg gtggtgttgg gctccatcat caccatgtgc ctcaatagcc      1140
     tgccagactt ccaaatccct gatagccagg gtaaccccgg tgaagacccc aggttcgaaa      1200
     ttgtggagca ctttggcatt gcttggttca catttgagtt ggtggccagg tttgctgtgg      1260
     cccctgactt tcttaagttc ttcaagaatg ctctaaacct tattgatctc atgtccattg      1320
     tcccatttta cataactcta gtggtgaacc tggtggtgga gagttctcct accttggcta      1380
     acttgggcag ggtggctcaa gtcctgaggc taatgaggat cttccgaatt ctcaagctgg      1440
     ccagacactc cactggcctc cgctccttgg gagccaccct gaagtacagc tacaaggaag      1500
     tggggttgct cttgctctac ctctcagtgg ggatttccat cttctctgtg gtggcctaca      1560
     ccattgaaaa ggaggagaac gaaggcctgg ccaccatccc tgcctgctgg tggtgggcca      1620
     ctgtcagtat gaccacagtt gggtacggag atgtggtccc agggacaaca gctgggaagt      1680
     tgactgcctc tgcctgcatc ttggcaggca tcctggtggt ggtcttgccc atcactttga      1740
     tcttcaataa gttctcccat ttctatcggc gccaaaagca acttgagagt gctatgcgca      1800
     gctgtgactt tggagatgga atgaaagagg tcccttcggt caatttaagg gactactatg      1860
     ctcataaagt taagtccctc atggcaagtc tgacaaacat gagtaggagt tcacctagtg      1920
     aactgagttt agatgattct ctacattagc tggaccccga cttacattgc tgatctgctg      1980
     cttgtggttc tagcacaatc agggcaattt tagggctgtg gcataagaaa tcatccctgc      2040
     cctagaggga gagctgcatg ggacataagc cctagattgc ttttgcaatg tttagagagg      2100
     tttctttttt cttttgagga tggtgtgtct aataacatgc ctttgcacct ctcagtgaag      2160
     tgacactcac tggtgtttgc atcatggcaa aaaaaaaaat gttcaccttt ctgccagatg      2220
     agtatctaga atgccaattt ctctgtccac tgtgtacagt attctaatgc tcatatccca      2280
     gcattacctg tgagtggaat tgtctgtgct cctatttccg aggctgctgt atgggttcca      2340
     gtgacaacac atctgtctat gaggtcagca aggatatcgt gagatttgga tcacaaccat      2400
     gtgaaaataa tctcaattat gtatcccttg ctttcattta cctttaatac caaaacagag      2460
     agatcgcaaa gctaagcaca cttgaccaat gcaaatcttc gagttgtctt tctacttggt      2520
     cctgtccttg tgatgtgcat gaatgcacca gtcattttaa agaaagatat gtattgatgt      2580
     atatctccta agtgtcagtg taaagagaat gttacttagt cgatatgtag taaagactga      2640
     atgtttttcc tccaaacagt taaatttagg gacagcgact ttagctaaac atggaccaaa      2700
     ccccaggagt tcatgtaggc taagcccttt tactgatggt caggcctctt ttcatttatt      2760
     tctggctgag atgctcaatc caggccattt tgaccaaagt ttgctgtgtc ttggtattag      2820
     catgtttttc aagcatctct tttttaagat gtttaggaat aaggccgtgc tgtctttctc      2880
     ctccactgga agaagtttgt gttttgttgt ctttgtgagg taagcactgt caggttgctg      2940
     gcaagggcaa tagcttaaat attttcttgc ctgctctaaa agcccataaa atgaatgttc      3000
     ttttgtttct gagcagagtt tcctttaggt agttttgctt ctaggacaca ggatagtgta      3060
     tgtatagtgt ttgattgcct tgagttcctg ccttggcatg gaaacctggt agtgcagagc      3120
     atattcaaga tgcagacatg catgaaggca ggtggcttac ccagggtgga aacactgtag      3180
     cttttatttc cattgcaatt gcaatggggt ttgggggaca ggggtagaag tcaaaagaaa      3240
     agagttataa agccaaaaac tactttataa gatataaata actgtgagct tctttaaaag      3300
     cttaaaacta gtaaaataga aaacaaaaac aacaaacaac cctttcaacc attaagctgt      3360
     gttgaagggt tacctctatt tccttttcca acacactgtt cagttaacac aaaacattat      3420
     gaaggggcac ctgggccccc tttaagaaaa ttctttccca tcattgtcta agtaatctga      3480
     tggttttcca gtggctttca ttattgttga gtctttggca aggctataga atccagggat      3540
     ccaaatacgg agataaacag gcttttaatc caaagtttgg gcctactctt aattggtcca      3600
     ttttgtgttt tagtcagtta aggacaatcc acacttcaca ggggtgtgga atggatcttc      3660
     tcagagggct ctgtgtacta gtggttgcca tggtgactac agtgtgggcg atttgttgga      3720
     tgaatgcact gaccatttaa tgcccttgag cctccagttc agatctttca tcagactgga      3780
     gactgatgag gggcagaagg tggcaacctc ctagtgccta cgtgcagaca catctatgtc      3840
     tattattcca aagcagcagg aatgtgaggt tgacttcaag gaaccccgcc tgtgaatcag      3900
     aagacaggag ttggttttgg gagtttgcat atggaactct tgttgttggc tggtatcttc      3960
     agcactagaa gaccaaggat gtataaaact gttcccagtt gcactgaagg caggggacag      4020
     cctaacctgt gaggactgtt tggtttgctg aggctgatgg tataccataa ctgggcatga      4080
     attgcatggt cactgaccat gaagctgatg g                                     4111
//


spacer
spacer