spacer

EBI Dbfetch

ID   AK048591; SV 1; linear; mRNA; HTC; MUS; 1430 BP.
XX
AC   AK048591;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130082O03 product:hypothetical Rhodopsin-like GPCR superfamily
DE   containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1430
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5356d50b264804e0d85aa78e8d6d1ec2.
DR   Ensembl-Gn; ENSMUSG00000042816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054738; mus_musculus.
DR   EuropePMC; PMC403690; 12819145.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130082O03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1430
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130082O03"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..968
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="hypothetical Rhodopsin-like GPCR superfamily
FT                   containing protein (InterPro|IPR000276, evidence:
FT                   InterPro)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q7TSN6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441887"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7TSN6"
FT                   /protein_id="BAC33383.1"
FT                   /translation="AYSKGVWDLGWFICKSSDWFTHVCMAAKSLTFVVVAKACFAYASD
FT                   PAKQESIHSRTIWSVLAGIWVVASLLPLPEWLFSTTRRHAGVEMCLVDVPAVAEEFMSM
FT                   FGKLYPLLVFCLPLLLAGVYFWRAYDQCKTRCTKTRNLRDQMRSKQLTVMLLSTAIISA
FT                   LLWLPEWIAWLWVWHVKAGGPMPPQGFIALSQVLMFFTSTANPLIFLVMSEEFKAGLKG
FT                   LWKWMITRKPAVTSEVQEAPAGNTEALPGKAPSPETQTCILDTDGRGSPDDSKEKSGKV
FT                   VAPILPDVEQFWHERDAVPSAQDNDPIPWEHEGQETEGCN"
FT   regulatory      1416..1421
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1430
FT                   /note="putative"
XX
SQ   Sequence 1430 BP; 374 A; 343 C; 337 G; 376 T; 0 other;
     gagcatactc caagggcgtt tgggatctcg gctggttcat ctgcaagtcc tctgactggt        60
     tcacccacgt gtgcatggca gccaagagct tgacatttgt tgtggtagcc aaagcatgct       120
     tcgcgtatgc aagtgaccca gccaagcaag agagtatcca cagccgcacc atctggtcag       180
     tgctggcggg catctgggtt gtagccagcc tgcttcccct gccagaatgg ctctttagca       240
     ccaccagacg tcacgcaggt gtggaaatgt gcctcgtgga tgtgccagct gtggcagaag       300
     aattcatgtc catgttcggt aagctctacc ctctgctggt gttctgcctt cctttacttc       360
     tggctggcgt ttatttctgg cgagcttatg accaatgtaa gacacgatgt acgaaaactc       420
     gaaatctgag agaccagatg cgttcaaagc aactcacagt gatgctgcta agcactgcaa       480
     tcatctctgc tcttctgtgg ctcccagagt ggatagcctg gctgtgggta tggcatgtga       540
     aggctggagg gccgatgcca ccacaggggt tcatagccct gtctcaagtt ctcatgtttt       600
     tcacctccac agcaaaccct ctcatttttc tagttatgtc tgaagagttc aaggcaggct       660
     tgaaaggcct atggaaatgg atgataacca gaaagccagc agttacttca gaggttcagg       720
     aggcacctgc tggaaacaca gaggcccttc ccggaaaggc tccatcacca gagacccaaa       780
     catgcatcct agacacagac ggacgtgggt ctcctgatga cagcaaagag aaatctggta       840
     aggtggtggc tcccatcctc cctgacgtgg agcagttttg gcacgagagg gatgctgtcc       900
     cttcagcaca agacaatgac cctataccct gggaacacga aggccaagag acagagggct       960
     gcaattaaca gacttgagtt tcaaagaaaa gcaaattgtc gttactgtgt ttacttgtac      1020
     cactgcttag caatattgat gaagtaaatt gccattagaa attgcaaaga tttctgcttt      1080
     caaactatag aacctggtaa gtagaaaggc atgtagcaat taggcttcag aactaaagtc      1140
     cgtctaaaga aatcaattga agtgctatgt aaagaaaact ttcagtgatt atagggctca      1200
     cgctggcttt cccccagggt atcccttaaa tctagccctg ttctgcagtg gctggagtag      1260
     tttatcagac tgagccaatg tactctgttt cttcctgaag ctgctaccct caatgtacca      1320
     gcaagttata tttcacctaa gcatagctca aaatctctat ctcctttggc tttttaaaac      1380
     tataaatttc acttgtaaat tctcttcact tgcttaataa atgttaattg                 1430
//


spacer
spacer