Dbfetch

ID   AK048567; SV 1; linear; mRNA; HTC; MUS; 3166 BP.
XX
AC   AK048567;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130076O07 product:hypothetical Immunoglobulin-like/Immunoglobulin
DE   C-2 type/Immunoglobulin subtype/Ig-like domain profile containing protein,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3166
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 110dae2b260a500d0462d385a3f3f008.
DR   Ensembl-Gn; ENSMUSG00000020598; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019712; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019676; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019647; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019654; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019458; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020101; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019011; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019430; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019543; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019532; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019613; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019568; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020141; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018778; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019061; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110748; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034773; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0034698; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0034682; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034696; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034476; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035195; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034398; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0034390; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0034533; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0034524; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0034672; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034534; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035243; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034079; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033940; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130076O07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3166
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130076O07"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             515..1297
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Immunoglobulin-like/Immunoglobulin C-2
FT                   type/Immunoglobulin subtype/Ig-like domain profile
FT                   containing protein (InterPro|IPR007110 InterPro|IPR003598
FT                   InterPro|IPR003599 PROSITE|PS50835, evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q810U4"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026966"
FT                   /db_xref="MGI:MGI:104750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810U4"
FT                   /protein_id="BAC33377.1"
FT                   /translation="MQLKIMPKKKHLSAGGVPLILFLCQMISALDVPLDPKLLHDLVQP
FT                   PTITQQSPKDYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTL
FT                   VINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKERLEPIVLQNGQSL
FT                   VLPCRPPIGLPPAIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARF
FT                   NHTQTIQQKQPISLKVISGKSSASGLSFNGVYLCGSNY"
XX
SQ   Sequence 3166 BP; 866 A; 690 C; 653 G; 957 T; 0 other;
     ggtcgctggc ggacgcgcgc cggagtccga gcctgagacg cgcgggcgcg agggaccgtg        60
     cagaaacgga gactggggca gctggaggcg acagcttcgg aagcttcgga aacacgcacg       120
     acagctgggc tccggggtct taggcagtag cgccccggca gggaggtggg cgcggcacga       180
     aaacgaattt ttgtgctgct ctccagtgaa agccagtacc cctatttgct gaaggctttt       240
     taaccaaggc tgctttcagc tcttgacatt acccagagaa aaggtggact cagaaatcag       300
     ggaagcattg gaggtttctg accctgagga tcttctgaag agcaatgcta agaaaacctt       360
     tggcttaagg aattaaaacg aaataccact tcttcaagta agaagaccta cttcaaagtc       420
     ccctgcatga aaaattattt aaacgccgca caccaatctt ccgtgagaga agaaaaggaa       480
     attccgtgcg tgggtctcag caggagtgca gctgatgcag cttaaaataa tgccgaagaa       540
     gaagcactta tctgcaggcg gagtgcccct gattctcttc ctgtgccaga tgatcagcgc       600
     gctggatgtt cctctcgatc caaagctcct tcatgacttg gtacaacctc caaccatcac       660
     tcaacagtca ccaaaagact acatcattga ccctcgggag aatattgtaa tccagtgtga       720
     ggccaaaggg aaacctcccc caagcttttc ctggactcgt aatggaactc actttgacat       780
     agacaaggac cctctggtca ccatgaagcc tggctcagga acccttgtca tcaacatcat       840
     gagtgagggg aaggcagaga cctatgaagg agtctaccag tgcactgcaa ggaacgagcg       900
     tggagctgcc gtctccaata acattgttgt ccgcccatct aggtcaccct tgtggaccaa       960
     ggaaagactt gaacctatag tactccagaa tgggcagtca ttagtacttc catgtaggcc      1020
     tccgattgga ttacctccgg ccataatatt ttggatggat aattcctttc agagacttcc      1080
     acagagtgag cgggtttccc aaggcctaaa tggagacctt tacttctcca atgtcctccc      1140
     agaggacacc cgtgaggact atatctgcta tgccagattt aatcacactc aaaccatcca      1200
     gcagaagcag cctatttctt tgaaggtgat ttcaggtaag agctcagcct ccgggctctc      1260
     tttcaatggt gtttacttat gtggatcaaa ttattaacaa ttaaatacag tttgactctg      1320
     aggtaaatca ggtcaatgac caagaacatt cctgcaaagg ctcactgaat cattagctta      1380
     tatgctagaa aaagcatgca taccctaaat attgtctttt acattttcca ctgattgcca      1440
     tttctgtttc cctggcaacc tcctgactct atggtgttct gagtattgct atatgcatta      1500
     tgccccaaag tgccatttct tggcatttat cctgtagatc aagttgcagt tgggggaggt      1560
     agagtggatt ctgagagagt cagcatgaag tcaagattat actttcctgg aaggaatggc      1620
     actaagccta gctgtatgcc tttgtttctg ctgcccaatg gtttttgacc cttgtcgcct      1680
     acttctgtgc cctcttcatg atattctgtt tatttcagtg gatgaattga atgacactat      1740
     agctgctaat ttgagtgaca ctgagtttta tggtggtgag ttacagtggt tgtaaccgat      1800
     attctcctcc ttcattgtag actttagttc actaacttca cctccatggc cacttaacct      1860
     tgtttctttg ggaaatttct agttccatgt ttaacatcac tgtatcaatg tgtgtttctt      1920
     aagaaactga gctgtaaacc ttcaagcatg tccctgaaac attttccatg gtgtatgtat      1980
     agttaaactt gctataaagt ttcgtgtaag ccatttcata tgctttagaa aaaaatctgt      2040
     catatgtgat tataattata tttttcatac tttgtgctgt ctataaactt tttgcatggc      2100
     ctacaatata aactgattgg tcgtattaac ccctagagca tcattagaac cttcagtaac      2160
     taacatagag tacattccgt agtaatcctc taaccttcct taagtttttc atgtcattat      2220
     tcagcagaat tagcaaccgt gttgtgttgc ttttagcttt gttagaaacc taatcaccgt      2280
     tttctgcggg aggaaacttt tcaaaataga tcagtcaact tcattgtatt aaactgaaac      2340
     aaattggatt tccttaaggc tgtcaagcat aaaatctgtc actaaacaat atggctcttt      2400
     attccccata gatggagttt ctgctacatt agtttttacc tttgaggtat gaacattgca      2460
     gaatatggca gatataatct catctttatt tattgaatat agttcttcca aatatgggcc      2520
     tcaagactct tgtcaaggtg atttttacag gagtaaggtc ccctaacaac ttctaaaatc      2580
     cttaggaaaa caatattttc tccagcaata ctattttggg gtcgttagat ttttctttgg      2640
     agaaatgaga agtttaccca gtgccttttc attgggtttt agaagcatca agtgcgtcat      2700
     ttgtggttga agcagtgaaa agtcttatga catttccact tgaaaatttc cccaggcctt      2760
     tagtagataa ggtcacatgt tttaaaagtc cacaaaacag aaggtgtctt gtttaactat      2820
     ttctaagctc tctgatttag accttcttta ttttgtcatt ggataaaatg atttccatgt      2880
     gttcggctct gccgctaact cttttctttt tttccaaagc tagggacgaa gcccagggcc      2940
     tgaccaatac taaacaacac tctgccatga agccactcct tcagctcctc tactgtaaat      3000
     ctgtattcag agcatataat ttcccagaac tctttagaaa ttctccagtt ttgttttatt      3060
     tttcataaac cttgcagtgt aggaattttg agatataggt tagtggcaag ggctataatg      3120
     ctatgtccag aataaatcaa aatactttgt ccataatgat ttgccg                     3166
//