Dbfetch

ID   AK048279; SV 1; linear; mRNA; HTC; MUS; 3494 BP.
XX
AC   AK048279;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130046C03 product:ceroid-lipofuscinosis, neuronal 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3494
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2cc00cecff1c75a2cef87ee01ac6a8fc.
DR   Ensembl-Gn; ENSMUSG00000030894; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032764; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032744; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032677; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032750; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032459; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033255; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031789; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032433; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032586; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032539; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032677; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032571; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033276; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031502; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031906; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033184; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085705; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085775; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085744; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085302; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086245; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085822; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085246; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085441; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085293; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085335; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086531; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085235; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084359; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130046C03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3494
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130046C03"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             22..1710
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="ceroid-lipofuscinosis, neuronal 2 (MGD|MGI:1336194,
FT                   evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:O89023"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="MGI:MGI:1336194"
FT                   /db_xref="UniProtKB/Swiss-Prot:O89023"
FT                   /protein_id="BAC33293.1"
FT                   /translation="MGLQARLLGLLALVIAGKCTYNPEPDQRWMLPPGWVSLGRVDPEE
FT                   ELSLTFALKQRNLERLSELVQAVSDPSSPQYGKYLTLEDVAELVQPSPLTLLTVQKWLS
FT                   AAGARNCDSVTTQDFLTCWLSVRQAELLLPGAEFHRYVGGPTKTHVIRSPHPYQLPQAL
FT                   APHVDFVGGLHRFPPSSPRQRPEPQQVGTVSLHLGVTPSVLRQRYNLTAKDVGSGTTNN
FT                   SQACAQFLEQYFHNSDLTEFMRLFGGSFTHQASVAKVVGKQGRGRAGIEASLDVEYLMS
FT                   AGANISTWVYSSPGRHEAQEPFLQWLLLLSNESSLPHVHTVSYGDDEDSLSSIYIQRVN
FT                   TEFMKAAARGLTLLFASGDTGAGCWSVSGRHKFRPSFPASSPYVTTVGGTSFKNPFLIT
FT                   DEVVDYISGGGFSNVFPRPPYQEEAVAQFLKSSSHLPPSSYFNASGRAYPDVAALSDGY
FT                   WVVSNMVPIPWVSGTSASTPVFGGILSLINEHRILNGRPPLGFLNPRLYQQHGTGLFDV
FT                   THGCHESCLNEEVEGQGFCSGPGWDPVTGWGTPNFPALLKTLLNP"
XX
SQ   Sequence 3494 BP; 861 A; 939 C; 712 G; 982 T; 0 other;
     gagatcagcc tgaaagccaa aatgggactc caagcccgcc tcctagggct ccttgctctc        60
     gtcatcgccg gcaaatgcac ttacaaccct gagccggacc agcggtggat gctgcctcca       120
     ggctgggtgt ccctgggccg cgtggatccc gaggaagagc tgagtctcac ttttgcgctg       180
     aaacagcgga acctggaaag actctcggag ctggtgcagg ctgtgtcgga tcctagctct       240
     cctcaatatg gaaagtacct aaccctggag gatgtagctg agctggttca accatcaccc       300
     ctgaccctcc tcactgtcca aaagtggctc tcagcagctg gagcccggaa ctgcgattca       360
     gtgaccaccc aggactttct gacttgctgg ctgagtgtcc gacaggctga gctgctgctc       420
     ccaggagctg agtttcatcg ctatgtaggg ggacctacaa agacccatgt tataaggtcc       480
     ccacatccct accagcttcc ccaggccttg gcccctcatg tggattttgt gggggggctg       540
     caccgtttcc ccccttcatc tccaagacaa cgtccagaac cacaacaggt aggaactgtt       600
     agcctgcact tgggagtgac tccgtctgtg ctccgtcagc gatacaacct gacagccaaa       660
     gatgtgggct caggcaccac caacaatagc caggcctgtg cccagttcct ggaacagtac       720
     ttccataact cggatctgac tgagttcatg cgcctattcg gtggcagttt tacacaccag       780
     gcctcagtag caaaagttgt tggaaagcaa gggcgaggcc gagctgggat cgaggccagt       840
     ctagatgtgg aatacctgat gagtgctggt gccaatatct ccacttgggt ctacagtagc       900
     cctggccgcc atgaggcaca ggagcccttc ttacaatggc tcctgcttct tagcaatgag       960
     tcatctttgc cacatgtaca tactgtgagt tacggagacg atgaagactc cctcagcagc      1020
     atctacatcc agagagtcaa cactgagttc atgaaggctg ctgctcgggg tctcaccctc      1080
     ctttttgcct caggtgacac tggagctggg tgttggtctg tctccggaag acacaagttc      1140
     cgccctagct tccctgcttc cagcccctat gttactacag ttggaggaac ctccttcaag      1200
     aatcctttcc tcatcacaga tgaagtagtt gactatatca gtggtggagg cttcagcaat      1260
     gttttcccac ggcctcccta ccaggaggaa gcagtggccc agttcttgaa atccagctct      1320
     catctaccac catccagtta cttcaatgct agtggccgtg cctacccaga tgttgccgca      1380
     ctatctgatg gctactgggt ggtcagcaac atggtcccca ttccatgggt atctggaacc      1440
     tcggcctcta ctccagtgtt tgggggaatt ttatccttga taaatgagca cagaatcctc      1500
     aatggccgcc ctcctcttgg ctttctcaac cccaggctct atcagcagca tgggacagga      1560
     ctctttgatg taacccacgg ctgccatgag tcctgtctga atgaagaagt ggagggtcag      1620
     ggtttctgct ctggtcctgg ctgggatcct gtgacaggtt ggggaacacc caacttccca      1680
     gccctattga agaccctgct caacccttga ccctttcgtg ccatgacgag aaagcagaac      1740
     tgttccctgt actaaaaggg aaggctcagt ttcttgttat tcctcgatag aagccctgct      1800
     gaactcctgt tgcctgctgc agatagcttc tccctaaccc tcagatgctg tgaacaggac      1860
     tcaactctca atcctactgt gtgccatcaa actcaggtct ccaaacttct acttcaagat      1920
     cctcaacaag atgctataac cagcatattt tgtctcaccc caaccccatc tctccttcct      1980
     ctttccagct tgagatgtga aagcagggca agaaggttca gtcttccatt actggcacta      2040
     gcaggtccac ccaacgctta ccacctctgc actgaccgta cactctattt ctcttcgggt      2100
     ttgcttttcc gttcactgaa gtgagacctt tgactaatcg ttttgtcttt cttctctcgg      2160
     cactgaagta caatggtctc cccaatgttt tatccagtta tacccttttc agtgtttgtt      2220
     ttatgggttt tcttatttaa gaacaggttg tcaaaaaacc attaaaaaaa aaaagaaaaa      2280
     gaacacattg gctgcaatct atttaactat ataactattc taaggaaagt taaaaattga      2340
     aaacttaaaa tgtttgaaat gttctcattg gcaaaattcc tcaacaaaat aaataggtca      2400
     ttacaaattt tgctttaaat ttttgcttga gtgatttttt tttttgtaaa gtgttttaaa      2460
     atttacattt tattttcccc ttctcagcta caccaaagca acattcaggt tttaatttca      2520
     actgtcagac attacaaaca tctagcttct gtgaacctgg gtgtttgttc tttccatcag      2580
     tttcccattt atcctttttc ctcagtgacc cccctctgac cacactaatc agcccccttt      2640
     tctgctgact ccagggatgc tgtgttcatt gttccattct tagtttcttg ctcttatcat      2700
     tttattatca tcccttgaca gatcactgac atctataccc acagtgagtg atacctcaaa      2760
     tgtgagatac ctcgttactt catctccctc cagcccagac ctaaactatt tcatctctta      2820
     atctatgata taatgcctct ttcaaacaag ccagaaacct ataactctta actctcatct      2880
     ttttcacctc cttactaact tcaaaaagtt ttcttgactg cctctcaagt atatctttat      2940
     cggctagtgt ggtgatgcac acctttaatc ccagcactca ggagacagag gccaggcaag      3000
     tctctgagtt tgaggccatc ctggtctata taaagagttc cagacaagcc aggcctacat      3060
     agtcagacca tgtctcaaaa atacacatat gtgcacacac acacatgcac aaaatactgc      3120
     attatctttg agcccatgtt cttttttctt ctaaactgca ggaagcactt ggggagagga      3180
     aaggcttccg aagcccctca tcttccaaac caagcagtct atgtatttgt gcaaaccctt      3240
     caaagattac tgggtaaaag tcagagacat tgaaacttgc cttcaaaatc gggaaataaa      3300
     cattgctaat gtctcacact tggaattaag caatgaatgt tagtttccct ttcttctttg      3360
     cactgcacct acatgtagct gggaaacaat catacagtat tgaaattgtc agtttgtttg      3420
     ccttcctttt ccagacagtc ggtgctagtg aactagaatc tgattcttaa ctttgtattc      3480
     ctaggtccca gccc                                                        3494
//