Dbfetch

ID   AK048276; SV 1; linear; mRNA; HTC; MUS; 3011 BP.
XX
AC   AK048276;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130045M17 product:similar to CALCIUM-ACTIVATED CHLORIDE CHANNEL-2
DE   [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3011
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 54c940d5b921b30f2401fb0e5c7f2677.
DR   Ensembl-Gn; ENSMUSG00000036960; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027957; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027916; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027882; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027928; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027658; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028371; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027111; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027633; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027773; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027740; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027884; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027773; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028430; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026834; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027191; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000040465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198993; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064150; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0064178; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0064121; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064101; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0063790; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0064595; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064106; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0063750; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0063864; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0063821; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0064006; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0063823; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0064815; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0063641; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063048; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130045M17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3011
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130045M17"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             69..2897
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="similar to CALCIUM-ACTIVATED CHLORIDE CHANNEL-2
FT                   [Homo sapiens] (SPTR|Q9Y6N2, evidence: FASTY, 72.1%ID,
FT                   100%length, match=2826)"
FT                   /db_xref="GOA:Q8BG22"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004727"
FT                   /db_xref="InterPro:IPR013642"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:2139758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG22"
FT                   /protein_id="BAC33291.1"
FT                   /translation="MTHRDSTGPVIGLKLVTLLFTLSPELLFLGAGLKLKENGYDGLLV
FT                   AINPRVPEDLKLITNIKEMITEASFYLFNATKRRVFFRNVQILVPATWTDHNYSRVRQE
FT                   SYDKANVIVAEQSEEHGDDPYTLQHRGCGQEGRYIHFTPSFLLNDELAAGYGARGRVFV
FT                   HEWAHLRWGVFDEYNNDKPFYVNGRNEIQVTRCSSDITGVFVCEKGLCPHEDCIISKIF
FT                   REGCTFLYNSTQNATGSIMFMPSLPSVVEFCNESTHNQEAPNLQNQVCSLRSTWDVITA
FT                   SSDLNHSLPVHGVGLPAPPTFSLLQAGDRVVCLVIDVSRKMAEGDRLLRLQQAAELYLM
FT                   QVVEAHTFVGIVTFDSKGEIRASLQQIYSDDDRKLLVSYLPTAVSTDAETNICAGVKKG
FT                   FEVVEERNGRADGSVLILVTSGADEHIANCLLTSMNSGSTIHSMALGSSAARKVGELSR
FT                   LTGGLKFFIPDKFTSNGMTEAFVRISSGTGDIFQQSLQVESVCETVQPQHQLADTMTVD
FT                   SAVGNDTLFLVTWQTGGPPEIALLDPSGRKYNTGDFIINLAFRTASLKIPGTAKHGHWT
FT                   YTLNNTHHSPQALKVTVASRASSLAMSPATLEAFVERDSTYFPQPVIIYANVRKGLHPI
FT                   LNATVVATVEPEAGDPVVLQLLDGGAGADVIRNDGIYSRYFSSFAVSGSYSLTVHVRHS
FT                   PSTSTLALPVPGNHAMYVPGYITNDNIQMNAPKNLGHRPVKERWGFSRVSSGGSFSVLG
FT                   VPDGPHPDMFPPCKITDLEAMKVEDDVVLSWTAPGEDFDQGQTTSYEIRMSRSLWNIRD
FT                   DFDNAILVNSSELVPQHAGTRETFTFSPKLVTHELDHELAEDAQEPYIVYVALRAMDRS
FT                   SLRSAVSNIALVSMSLPPNSSPVVSRDDLILKGVLTTVGLIAILCLIMVVAHCIFNRKK
FT                   RPSRKENETKFL"
XX
SQ   Sequence 3011 BP; 820 A; 736 C; 737 G; 718 T; 0 other;
     gacattgatc agctgactca aggtacccag caggctcccc gtgaataaac cagaggtttc        60
     actgcaagat gacccacagg gacagcacag gacctgtcat cgggctgaaa cttgtgaccc       120
     ttctgttcac cctaagtcca gaacttctgt tcctgggagc tggattgaag ctgaaagaga       180
     atggctatga tggattgctt gttgccatca atccccgggt acccgaggat ctgaagctga       240
     ttacaaacat taaggaaatg ataaccgaag cttcctttta cctgttcaat gcgaccaaga       300
     ggagggtgtt tttcagaaat gtacagattt tagtacctgc cacttggacg gatcataatt       360
     acagtagagt aagacaagaa tcctatgaca aggcaaatgt catagtggct gagcagagtg       420
     aggaacacgg agatgatccc tacaccctac agcacagagg gtgtgggcaa gaggggagat       480
     acatccactt cacccccagc ttcctactca acgatgagtt agccgcaggc tatggtgcgc       540
     gaggcagagt gtttgtccac gagtgggccc atctccgctg gggtgtgttc gatgaatata       600
     acaacgacaa accgttctac gtgaatggac ggaatgagat tcaagtcacc aggtgttcat       660
     ctgacattac aggcgttttt gtgtgtgaaa agggcctctg cccccatgaa gactgcatta       720
     ttagcaagat ttttagggaa ggatgcacat tcctctacaa cagcacccag aatgcaactg       780
     gatcaataat gttcatgcca agtttacctt ctgtggttga attctgtaac gaaagtacac       840
     acaaccaaga agctccaaac ctccagaacc aagtgtgcag cctcagaagc acttgggacg       900
     tgatcacagc ctcctccgac ctgaaccata gcctccccgt gcatggggtt ggacttccag       960
     cccctcccac gttctccctc ttgcaggctg gtgaccgagt ggtctgctta gtgattgatg      1020
     tgtccaggaa gatggcagag ggagacagac tgctccgact tcaacaagca gccgaactgt      1080
     acttgatgca ggttgtcgaa gctcacactt tcgtgggcat tgtcactttt gatagcaaag      1140
     gagaaatccg agcctcgctg cagcaaattt acagtgacga tgaccggaag ctgctggttt      1200
     catacctgcc gaccgccgtg tccactgacg cagaaacgaa catctgtgca ggggttaaga      1260
     aaggctttga ggtggttgag gagcggaatg gaagagctga cggctctgtc ctgatattag      1320
     tgaccagtgg agcagatgaa cacattgcca actgcctgct cacctcgatg aacagtggat      1380
     ccaccattca ctccatggcc ctgggttcct ctgcagccag aaaagtgggg gaattatcgc      1440
     gtcttacagg aggtctaaag ttcttcattc cagataaatt tacttctaat ggaatgactg      1500
     aagctttcgt tcgaatctct tctggaacag gagacatttt ccagcaaagc ttacaggttg      1560
     agagcgtgtg cgaaactgtg caaccccagc accagctggc ggatactatg actgtggata      1620
     gcgccgtggg caatgacaca ctttttctag tcacgtggca gactggtggc ccccctgaga      1680
     ttgcattatt ggatcctagc ggaagaaaat acaacactgg tgactttatc atcaacctgg      1740
     cctttcggac agccagcctt aagattccag ggacagctaa gcatgggcac tggacttaca      1800
     cgctgaacaa cacccaccat tctccccaag ctctgaaagt gacagtggcc tctcgtgcct      1860
     ccagcctggc catgtcccca gccactctgg aagcctttgt ggaaagagac agcacctatt      1920
     ttcctcagcc agtgatcatt tatgcgaatg tgaggaaagg tctgcatccc attctcaatg      1980
     ccaccgtggt ggcgacagtg gaaccagagg ctggagatcc cgttgtactg caacttttgg      2040
     atggcggagc aggtgcagat gttataagaa atgatgggat ttactccagg tatttttcct      2100
     cctttgctgt aagtggtagc tatagcctga cagtgcatgt ccgtcactct cccagcacaa      2160
     gcacactagc cctccctgtc ccaggaaacc atgctatgta tgtaccaggt tacataacaa      2220
     acgataatat tcaaatgaat gctcccaaaa acttgggcca cagacctgtg aaggagaggt      2280
     ggggcttcag tcgagtgagc tcgggaggct ccttctccgt gctgggagtc ccagacggcc      2340
     cccaccctga catgtttcca ccgtgcaaaa ttactgacct ggaagccatg aaagtggaag      2400
     acgacgtcgt cctctcttgg acggcacctg gggaagactt cgatcagggg caaactacaa      2460
     gctatgaaat aagaatgagc agaagcctat ggaacattcg ggatgacttt gacaatgcca      2520
     tcttggtgaa ttcgtcagag ctagttcctc agcatgctgg caccagggag acatttacat      2580
     tctcacccaa gcttgtcacc catgaacttg atcatgaact tgctgaagat gcacaagaac      2640
     cctacatagt gtatgtggcc ctgagagcca tggatagaag ctccctcagg tcagctgtgt      2700
     caaacattgc cctggtatca atgtctcttc ctccaaactc ttctcctgta gtgagcagag      2760
     atgatctgat cctgaaagga gttttaacaa cagtaggttt gatagcaatc ctttgcctta      2820
     ttatggttgt agcacactgt atttttaaca ggaaaaagag accatcaaga aaagagaatg      2880
     agacaaaatt tctatgaaca agcaggcaca gtatcttcct tcttaggtag gatggacatg      2940
     acctttacat ccacaaaata aaatgtgaac aaaatcaaaa tagtctcgac atggggactt      3000
     ttacataatg c                                                           3011
//