Dbfetch

ID   AK048249; SV 1; linear; mRNA; HTC; MUS; 2576 BP.
XX
AC   AK048249;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130043E08 product:alpha-methylacyl-CoA racemase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2576
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9a1ae5664122dddebd189609af71d87d.
DR   Ensembl-Gn; ENSMUSG00000022244; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021727; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021687; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021665; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021694; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021470; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022133; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020986; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021439; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021563; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021541; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021631; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021566; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022156; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020729; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021042; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000070877; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040622; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0040584; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040545; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0040584; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040320; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0041050; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040354; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0040240; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040390; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040351; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0040456; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0040342; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0041099; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039950; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039723; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130043E08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2576
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130043E08"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             56..1201
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="alpha-methylacyl-CoA racemase (MGD|MGI:1098273
FT                   GB|NM_008537, evidence: BLASTN, 99%, match=1461)"
FT                   /note="putative"
FT                   /db_xref="GOA:O09174"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="MGI:MGI:1098273"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09174"
FT                   /protein_id="BAC33284.1"
FT                   /translation="MVLRGVRVVELAGLAPGPFCGMVLADFGAEVVRVNRLGSTGENFL
FT                   ARGKRSLALDLKRSQGVTVLRRMCARADVLLEPFRCGVMEKLQLGPETLLQDNPKLIYA
FT                   RLSGFGQSGIFSKVAGHDINYLALSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGI
FT                   VLALFERTRSGRGQVIDSSMVEGTAYLSSFLWKTQPMGLWKQPRGQNILDGGAPFYTTY
FT                   KTADGEFMAVGAIEPQFYALLLKGLGLESEELPSQMSSADWPEMKKKFADVFAKKTKAE
FT                   WCQIFDGTDACVTPVLTFEEALHHQHNRERASFITDGEQLPSPRPAPLLSRTPAVPSAK
FT                   RDPSVGEHTVEVLREYGFSQEEILQLHSDRIVESDKLKANL"
FT   regulatory      2557..2562
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2576
FT                   /note="putative"
XX
SQ   Sequence 2576 BP; 636 A; 644 C; 614 G; 682 T; 0 other;
     gagataaact gtggctcggg cgccgagccg ctccgctctc accctaaggc tggccatggt        60
     gctgcgtggc gtcagggttg tggagctggc aggcctggcc ccggggccgt tctgcggaat       120
     ggtcctggcg gacttcggcg ccgaggtggt gcgcgtgaac cggctgggct ccacgggcga       180
     gaattttctg gcccgaggca agcgctcgct agcgctggac ctgaagcgct ctcagggagt       240
     cacggtgttg cggcgcatgt gcgcacgcgc ggacgtgttg ctggagccct tccgctgcgg       300
     tgtcatggag aaactccagc ttgggccaga gactctactg caggacaatc caaagctcat       360
     ctatgccagg ctgagcggat ttggccaatc gggaattttc tccaaagtag ctggccatga       420
     catcaactat ttggctttat caggcgttct gtcaaagatt ggcagaagcg gtgagaaccc       480
     ctacccaccg ctgaatctcc tggctgactt tggcggtgga ggcctcatgt gcacactggg       540
     cattgtgctg gctctctttg aacgcacacg ctctggccga gggcaggtca tcgattcaag       600
     catggtggaa gggactgcat acttaagttc tttcctgtgg aaaacccagc ccatgggtct       660
     gtggaaacag cctcgaggac aaaacatctt agatggcggt gcacctttct acacaaccta       720
     caagacggca gacggggagt tcatggctgt aggtgccata gaaccccagt tctatgcact       780
     gctgcttaaa ggacttggac tcgagtctga ggaactcccc tcccagatga gctcagcaga       840
     ttggccagag atgaagaaga aatttgcaga tgtgtttgca aagaagacta aggcagaatg       900
     gtgccagatc tttgacggga cagatgcgtg tgtgacccca gtgctgacgt ttgaggaggc       960
     cctccaccac cagcacaaca gagaacgggc ctccttcatc actgatgggg agcagctccc      1020
     gagcccccgc cctgcacctc tgctttccag aactcctgcc gtcccatctg ccaaaaggga      1080
     cccttctgta ggggagcaca ccgtagaagt gcttagagag tatggattca gtcaggaaga      1140
     gatccttcag ctgcactcag atagaatcgt tgaaagtgat aagctaaaag ccaatctctg      1200
     actcaggctt atagctcaag agaatctgaa ggctgcatct ccactgggga gggatgccca      1260
     caattgtgtg tatggaaatg tggatgaaca gcaatgaagt catccaaata tcccaatcac      1320
     gatccaacga aaggctggtt acaggataac gattgcgccc ttacgctgct tatcagagcc      1380
     tctgattgag gaaaatttgt gtgtgtgtac tgatagtaac ttgtggcagc tttctgcctt      1440
     tcagttccct tggtgaagtg tatccattta ttaaaaccct tttataaata caactctgat      1500
     catatattaa ataaactatt ataactttaa taaataaaac tcttgttttc ctcctcaaag      1560
     tgagcagtgg ttttaagttg taaaagcttt ttagaaagcc ctttaaatac catttatata      1620
     acattttcta atgcactgaa atattggggc actaccggga acaaaattca gaccctttaa      1680
     aaaaaaggca aacctttcat cccctgcttt tatttgaact ctgatgttaa tgaatggtct      1740
     tgcggttttc tttataaagc cctgcttcag atcactgttc tggctgctat gggtgaggag      1800
     ccctgtgctc tgttctccat caccttgcag caagcctttc cctcagtaga ctgtcctgtc      1860
     tccagtgcag acctgctgag ctccctccat cagggtctgc ttctgtactg attatgtctc      1920
     cacctgctta ccctctcgaa aatcccaagg aaaaggaact tgaagcaaac aagtaagtaa      1980
     ggaggtatag gaggcaatag gagaacacgc aatacccgga agacttcgta ctgaattgca      2040
     caccagtgac agccatgacg gacagctggg atgagctctg ggtgccaagc gagcttccca      2100
     tcctgggaaa tctctttaca gcttcaaaag atgctaatgg ctttttcagg ctgggccagg      2160
     tcagaggttc atggtttccc ctgcccagtg ctggagttca catttccata gaaacctaat      2220
     ccctcatcac ttaatggctt cctaactctt ggaaaatgtc cgttttttaa aaaatgtatt      2280
     tattctttga agttattatc tgtgtataca atgtatcttg atcatctcta cccctcatcc      2340
     gcccccccac aacacccaac cctgcttgtc tcccgcccaa cggtttgttt cgattctgtt      2400
     tgtcttgact ttgaatacca ttgttttgct tttatttctg tcatgttacc tttctggtaa      2460
     agttttttga tgcaagacta gcctttccag ccctgcaaaa ttttgcaata gtgttttttc      2520
     ccctcctata ggataaaact cgatcttacc aacaataata aataacagta aatctc          2576
//