spacer

EBI Dbfetch

ID   AK048122; SV 1; linear; mRNA; HTC; MUS; 3117 BP.
XX
AC   AK048122;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130036A21 product:SPROUTY HOMOLOG 4 (SPRY-4) homolog [Mus musculus],
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3117
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7820bd6fefb98fd731cdad3bd60f8c36.
DR   Ensembl-Gn; ENSMUSG00000024427; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025295; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130036A21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3117
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130036A21"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             225..1127
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="SPROUTY HOMOLOG 4 (SPRY-4) homolog [Mus musculus]
FT                   (SWISSPROT|Q9WTP2, evidence: FASTY, 100%ID, 100%length,
FT                   match=900)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9WTP2"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="InterPro:IPR030790"
FT                   /db_xref="MGI:MGI:1345144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTP2"
FT                   /protein_id="BAC33249.1"
FT                   /translation="MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMK
FT                   TSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSS
FT                   STSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEAC
FT                   GKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCAD
FT                   HPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
FT                   VICKAASGDTKTSRSDKPF"
XX
SQ   Sequence 3117 BP; 690 A; 848 C; 798 G; 781 T; 0 other;
     gaacatcgcc gctgaggcag cgaacagagc tgacagcgcg gagctggcgc tgcagggctc        60
     agggagcttt gccggctcct ccgactgacg tctgcgactt caacggcgac tgacccactc       120
     gggttcgggg atttacacag acgtggagcg atgcttgtga ctctgcagct cctcaaagac       180
     ccctagaagc ctgtcccttg gtgcagttca ggacctccag cctcatggag cccccggttc       240
     cacagagcag cgtccctgtg aatcccagct cagtcatggt gcagcccctc cttgacagca       300
     gagcgcccca cagccggctc cagcacccac tcaccatctt acccattgac cagatgaaga       360
     ccagccacgt ggagaatgac tacatagaca accctagcct ggcccctgcc acgggtccca       420
     agcggccccg gggcgggcca ccagagctgg ctcctacacc tgcccgctgt gaccaggata       480
     ttactcacca ctggatctcc ttcagcggtc ggcccagctc tgtaagcagc agtagcagca       540
     cttcctccga ccagaggctc ctagatcaca tggctccacc gcccgtggct gagcaggcct       600
     cacccagggc tgtgcgcctc cagcccaagg tggttcactg taagccgctg gacctcaaag       660
     gcccgacagc tccgccagag ctagacaagc acttcttgct gtgtgaggcc tgtggaaagt       720
     gtaagtgcaa agagtgtgcg tcccctcgga cgttaccttc ctgctgggtc tgcaaccagg       780
     agtgcctgtg ctcggctcag acgctggtca actatggcac atgcatgtgt ctggtgcaag       840
     gtatcttcta tcactgtact aatgaggatg atgagggctc ttgcgccgac cacccctgct       900
     cctgttccgg ctccaactgc tgcgcccgct ggtccttcat gggcgccctc tctgtggtgc       960
     tgccctgtct gctgtgctac ctgccggcca caggctgcgt caagctggcc cagcgaggct      1020
     acgaccgcct gagacgcccc ggttgccgct gcaagcacac gaacagcgtc atctgcaagg      1080
     cagccagtgg ggacaccaag accagcaggt ctgacaagcc tttctgacac tttggatgaa      1140
     aaaaacatgg tccctcctgc cagtctcctg agactgacct tgctcatctg tcctctccta      1200
     aaaccctaga ttgggaagaa accggcagag aacactactg cctagccttg agtccccaaa      1260
     aggatgaaga tgtactttgg ggattttcac agtcttgaaa ctttgttaaa cagcagtgac      1320
     agtgttaggg tatggtggta gggggcccag ttttcctatt tcagaagacg gaagacagat      1380
     gcggacacag ggtctgcaag ttcagccact caatggcctt cccagcccct ctgcttcctc      1440
     tcattttgcc attctctctg gctcctgctg gagccttcta cctgggagga acagctaatg      1500
     ggaggcaaga tacctcgagg aagaccctcc gagccttgac ttctatcttt gccgcctccg      1560
     tccatgcctg ttggccttgg cctcttggga aggtgcaccg tagccattcc tgctgtatgc      1620
     acttgatgtc cgagaacaaa atcgccggta agctgctgcc tcccgtgagt agcaggatgg      1680
     agaaggaacc acctggcagt gtgttcctcc tagctttcaa tcactaactt gggggttgtc      1740
     cgctcatcac gccatcctcc agttcacaga ctggcctgcc tgctatgcgt cctgagcact      1800
     ctttctactc ggattctttg tagaaactcg ctgggttaag aaggccagga tgacacaagc      1860
     aagaccaaat atcattttgc caatgagtct gaggctgtgg tctctggatc cagccatgat      1920
     gtttttatat gtttaattaa actagatgct attggtgttt aaacaataat aatacaacaa      1980
     ccttgcttcc ttttgggcca cccccaggaa gggctgattt caaaatctgg gggtaagcaa      2040
     cctcaaggag cgtttcccct gcacatcgag aatggcaaag aagaggccgt acctcccatt      2100
     ggcaggatga cagttgagcc gaactggggt tgggttttct tgtgattctg ctgcttgctg      2160
     tctctagcct tttgtgtata gtgatgcgtc tgtctttatg taaatagaga tgacagagtc      2220
     tattttagtg ttaagaagcc ctggtgggga agtcggaaga tgccagagaa ggtggggaac      2280
     gatcctccag gggctgctgg gtttgagccc cactttttgt gtgcacacac acagacaccc      2340
     ctcccaacag cccccaaaga cgtagcaact ctttctctca cggtgctaaa ggactcagaa      2400
     cgcgcagccc gtccagtggg taggtacttg ttgcatgcaa aaagctatcg tgtctctggt      2460
     ccttgccccc agctgttgtg tgggtgggtt ttttttgttt tttttgtttt tttttttgtt      2520
     gttgtttttg gttttggttt tttctttgtg tggtattttg tccccatccc tgcctctgat      2580
     tcaagaaata gcctgggtca gaagaggtac cccaggtaaa attgagagag cattaggcaa      2640
     aaatcatgtg gagcatttct ggttcttttg tgtgagcagc ccctagggag gaggcaagga      2700
     gtcaggtagc tgtaagtgga gtgtacctat tgctcttttc tcaaggattc acccccaccc      2760
     ccaccttgga agctactagt agtaatagta acaccttatg atttagaata agttaattgt      2820
     aaccataggt atttattgat tggaggaagg gagggtttta ttttcagctt tatttatgca      2880
     acatttactg gcttgtaaaa ggcaagtata aaatcctgca tcttcatcgt ctataactaa      2940
     tccatacata tacctgccct tgccacattg cagtgttctt gcacagaacg gaaggaaaga      3000
     tagaagacaa acccctgcga tcagcaaacc acttacacta attgaatgta ttagaagctt      3060
     tctgaagggg ctggagatgt tttcctcgaa tgaggggtgt ggagggaccc ccccccc         3117
//


spacer
spacer