Dbfetch

ID   AK047733; SV 1; linear; mRNA; HTC; MUS; 1430 BP.
XX
AC   AK047733;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male corpus striatum cDNA, RIKEN full-length enriched
DE   library, clone:C030018L03 product:METABOTROPIC GLUTAMATE RECEPTOR 7
DE   PRECURSOR homolog [Rattus norvegicus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1430
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 046258020802623b336be5ee535a11e1.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C030018L03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1430
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C030018L03"
FT                   /tissue_type="corpus striatum"
FT                   /db_xref="taxon:10090"
FT   CDS             288..>1430
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="METABOTROPIC GLUTAMATE RECEPTOR 7 PRECURSOR homolog
FT                   [Rattus norvegicus] (SWISSPROT|P35400, evidence: FASTY,
FT                   100%ID, 41.6%length, match=1143)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BKZ1"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR001883"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351344"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BKZ1"
FT                   /protein_id="BAC33142.1"
FT                   /translation="MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRI
FT                   EGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGAR
FT                   ILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSI
FT                   MVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVS
FT                   TLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSR
FT                   AVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKR
FT                   ATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKLTISGS"
XX
SQ   Sequence 1430 BP; 331 A; 409 C; 397 G; 293 T; 0 other;
     gagtgcttgg ctgttggaga gcgcgagcgg caagccaggg agcggggagc gcaagctggt        60
     gcacgggcca gcggagctac agtgccaggt gccaaagact ggctgacgcc ctgggacccc       120
     ccacccctct cctgctgcac ctcctctgtc tcctccaccc tctgtgccta cagaagtccc       180
     cggggcttcc cccgaaagga gctcacctcg agaagccggg acctgggaga gcccaccagc       240
     atcccctcca gcgccgccgc cgctaccgca gcagcatccg gagcggcatg gtccagctgg       300
     ggaagctgct ccgcgtcctg actttgatga agttcccctg ctgcgtgctg gaggtgctcc       360
     tgtgcgtgct ggcggcggcg gcgcgcggcc aggagatgta cgccccgcac tcgatccgga       420
     tcgaggggga cgtcaccctt ggggggctgt tcccagtgca cgccaagggt cccagcggag       480
     tgccctgcgg cgacatcaag agggagaatg ggatccacag gctggaagct atgctttatg       540
     ctctcgacca gatcaacagc gatcccaacc tgctgcccaa cgtaacgtta ggcgcgcgga       600
     tcctggacac ttgttccagg gacacttatg cgctcgaaca gtcgctcact ttcgtccagg       660
     cgcttatcca gaaggacacc tccgacgtgc gttgcaccaa cggagagccc ccggttttcg       720
     tcaagccaga gaaagtagtt ggagtgattg gggcttcggg gagctccgtc tccatcatgg       780
     tagccaacat cttgaggctt ttccagatac ctcagattag ttatgcatcc acggctcctg       840
     aactcagtga tgaccgtcgc tatgacttct tctctcgcgt ggtcccacct gattccttcc       900
     aagcccaagc tatggtagac attgtaaagg cattgggctg gaattatgta tctactcttg       960
     catctgaagg aagctatgga gagaaaggtg tggagtcctt cacacaaatt tccaaagaag      1020
     caggtggact ctgcattgcc cagtccgtga gaattcccca agaacgcaaa gacaggacca      1080
     ttgactttga tagaattatc aaacagctct tggacacccc caactccagg gctgtcgtga      1140
     tttttgccaa cgatgaggat ataaagcaga tccttgcagc agccaaaaga gctgaccaag      1200
     taggacattt tctctgggtt gggtcagaca gctggggttc caaaatcaac ccactgcatc      1260
     agcatgaaga tattgcagaa ggagccatca ccatccaacc taagagagcg actgtggaag      1320
     gatttgatgc ttacttcaca tcccggacac ttgaaaacaa caggagaaat gtatggtttg      1380
     ccgaatactg ggaagaaaac ttcaactgca agttgacaat tagtggatcc                 1430
//