spacer

EBI Dbfetch

ID   AK046613; SV 1; linear; mRNA; HTC; MUS; 2507 BP.
XX
AC   AK046613;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched
DE   library, clone:B430205N08 product:adenylate kinase 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2507
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 17cea3062e591172308dc9e3259a601f.
DR   Ensembl-Gn; ENSMUSG00000026817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113278; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B430205N08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2507
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="4 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B430205N08"
FT                   /tissue_type="adipose"
FT                   /db_xref="taxon:10090"
FT   CDS             153..737
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adenylate kinase 1 (MGD|MGI:87977 GB|NM_021515,
FT                   evidence: BLASTN, 99%, match=1923)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9R0Y5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028582"
FT                   /db_xref="MGI:MGI:87977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0Y5"
FT                   /protein_id="BAC32808.1"
FT                   /translation="MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA
FT                   EVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEE
FT                   FEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISF
FT                   YDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK"
FT   polyA_signal    2488..2493
FT                   /note="putative"
FT   polyA_site      2507
FT                   /note="putative"
XX
SQ   Sequence 2507 BP; 545 A; 674 C; 677 G; 611 T; 0 other;
     ggacatacta gtggtgtcgc gagcccctgt gggcacactt ccacctccat gtaaaggctg        60
     ctgggaaact ggatcctgtg tctgcataga atttcttcca cgagcctctg ctcacccaca       120
     gagtgctgac ctagctccca gatctcagca ggatggaaga gaagctgaag aaggccaaga       180
     tcatctttgt ggtgggcgga cctggctcag gaaagggcac ccagtgcgag aagattgtac       240
     agaaatatgg ctacacccac ctgtctactg gggacctgct tcgggcagaa gtcagctctg       300
     gatcggagag gggcaagaag ctgtcggcta tcatggagaa gggagagcta gtgccactgg       360
     acacggtgct ggacatgctc cgagatgcta tgttagccaa agtggattct tccaatggct       420
     tcctgatcga cggctacccg agggaggtga aacagggaga agaatttgaa cagaagattg       480
     gacagcccac actgctgctg tatgtggacg caggcgccga gaccatgacc caacgactcc       540
     tgaagcgagg ggagaccagt ggccgcgtgg atgacaacga ggagaccatc aagaagcggc       600
     tggagactta ttacaatgcc acagaacctg tcatctcctt ctatgacaag cgtggcattg       660
     tgcgcaaggt caatgccgaa ggcacggtgg acactgtctt ctctgaggtc tgcacctatc       720
     ttgactccct gaagtaactg gatcccttgg ccagctccca gcccgcccca cccttgctcc       780
     ctgaccccag gcagcctggc tcaagcccag cacctccacc ctgccgggct gtgcacagac       840
     acaggaagcc atgttatcct gtcccatgga cactaaagaa attgccaagg agggttagga       900
     ttgctccttt cctttgcttc cagttatggt gattcatgct gccacagccg gaggccccag       960
     cgtggccggc ccattcttcc ctgtgcctca gcccagctgt cttgtctccc tctggctctg      1020
     ctgggatcct aggcccttcc ttagccaggc tgtgtcaaag cctaggggtc cctgggttgg      1080
     caggctgctc tggggggtct ggtgttcacc ctgtttctca tagcctcgtt gtgtggcttt      1140
     ggccctaagc cattgtctct ctggagtgag ttttcttttt ttctttcttt ctttttcttt      1200
     tttttctttc tctgtttctt tctttttttt tttttttaag acagcatctc gtgtgactta      1260
     agctggcctc aaccctgtta tgtaactaag ggcaacctta atccttctgc ctccacttgt      1320
     cttcctgtgt gctgagatta caggtgtgtg tgtggacctc caccactcct ggttttgggg      1380
     gcactgggaa tcaagcccat ggccctgtat acgaggccag cacgctacag agtgagctgc      1440
     atcccgggct gggcaggttt tctgtgcctg actggggtct ggcatgggca aagggcaaag      1500
     ggccatgggc tcaccagctg gggccacgtg gtcactgggt gccaaggagc tgtgcaatgg      1560
     gcatacagct aggtgggaag ctggggtcag gggtggcctt cctgaagaag gctcccttgg      1620
     tatagacctg ccaggccttg ccatcctttg gctggtttta aagcttgtcc tgtcacgcta      1680
     tgtcccaacc cttatcctcg gcgttaagac aagagcatgc agattaagga gtgtgagctg      1740
     ccatagacaa ggatgtggga tcaaggacca ggcctgggac ccggagagga cacccaggga      1800
     tgccaagaag agctggcatc tctcttctgc tctttattct ttggtctcat tacacaggaa      1860
     gcctctgttg gtactcactt gtcctggggc cccgtctcca tccctagtga cttcccctgt      1920
     aagcccagat agcctgtaag ccagcagcca tggctgtccc agggacacct gcccctgggg      1980
     gtgacggtgc tcactccttt ctgtttacta ccagtggggc cacctttcct tctgcattgc      2040
     ctatttaagc tgtcctttaa aataaataaa tgtatttcag ttataagaag tgagtgtatt      2100
     gaaacacagg gaggttcaga ggaagagggc aggcatcacc aggcacagcc ttctgcctga      2160
     tcaggtttgc ctctgtcccc cagggtgact tcaggaaagc aaaaggctct ggagccccgc      2220
     accagtctgt gacagctctg ctccaatgct gtgtgcatgt gcatatacac acagacacgc      2280
     atgagcgcac ataggcatgt gcacacatgc acacgcacac tgcagccccg ctgaacatgg      2340
     atctcttaag gccggcctag gagcagacag aggatgcaca gaagagggga aagctggaga      2400
     aaacggcctg aaaaatcccc attatcttaa tgtgctaatt acagctcaat taattcaagt      2460
     gggtcccagt ttatgaagac ctggctgatt aaactagaaa attctcc                    2507
//


spacer
spacer