spacer

EBI Dbfetch

ID   AK046591; SV 1; linear; mRNA; HTC; MUS; 2220 BP.
XX
AC   AK046591;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched
DE   library, clone:B430114K07 product:hypothetical Uncharacterised protein
DE   family Hly-III/UPF0073 containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2220
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a99d78d7463d4a95165c4ca762d9d87b.
DR   Ensembl-Gn; ENSMUSG00000030168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169744; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B430114K07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2220
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="4 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B430114K07"
FT                   /tissue_type="adipose"
FT                   /db_xref="taxon:10090"
FT   CDS             160..1011
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Uncharacterised protein family
FT                   Hly-III/UPF0073 containing protein (InterPro|IPR004254,
FT                   evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BQS5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:93830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BQS5"
FT                   /protein_id="BAC32799.1"
FT                   /translation="MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPS
FT                   LETPVCSSYYENSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMGEFVCKVWEGRWR
FT                   VIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLG
FT                   IFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSG
FT                   IALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGE
FT                   CM"
XX
SQ   Sequence 2220 BP; 537 A; 486 C; 524 G; 673 T; 0 other;
     gacacaacac aagaatccgt ggagctcagc agtaccctca gactctggtc tacaactctg        60
     acaggatttg gggtcaactt accatccctt aaaaatccat tctcccaaga agaagggaca       120
     gaaagaaaga ccactttgta agaaaggctt tggtatccca tgaacgagcc agccaaacac       180
     cgattggggt gcaccaggac tccagagcca gatatacggc tcagaaaagg gcaccaactt       240
     gatgatacaa ggggaagtaa taatgacaac taccaaggag atttggagcc cagcttagag       300
     acacctgttt gttcttccta ttatgaaaat agcccggagg agcccgagtg tcatgatgac       360
     aattcccagg aagatgaagg gtttatgggc atgtccccgc tcctacaggc ccatcatgct       420
     atggaacgaa tgggagagtt tgtttgtaag gtgtgggaag gccgatggcg agtgatccct       480
     cacgatgtgc taccggattg gcttaaggat aatgacttcc ttctccatgg acaccggcct       540
     cctatgcctt cctttcgggc ctgttttaag agcattttta gaatacacac agagacgggc       600
     aacatttgga cacatctcct aggttgtgta ttcttcctgt gcctggggat cttttatatg       660
     tttcgcccaa atatatcttt tgtggcccct ctgcaagaga aagtggtctt tggcttgttc       720
     ttcttgggag ccattctctg cctttccttt tcatggctct tccacacggt gtactgccac       780
     tcagaagggg tctcccgact cttctctaaa ttggattact ctggtattgc tcttctgatc       840
     atgggaagtt ttgttccttg gctttattat tctttctact gtaacccaca accttgcttc       900
     atctacctga ttgtcatctg tgtgctgggc attgcagcca ttatcgtctc tcagtgggac       960
     atgtttgcca cccctcagta tcggggggtc agagcaggtg agtgcatgtg agtgtgcagt      1020
     tatcaccggt cattcaaggt gcaccattag aatcagaggc tgtgcttttc agtgcagaga      1080
     cacagtaact gtcctgcttg tccttaggct tctgacctgg tgctcagtta ggaggaagca      1140
     cagggttgaa gggcagcgat aagatgggtg cgcacctata ttttgagcag tgttgtttat      1200
     ttgaggaaat atcacaatat aatgacttct gtattctttc agattagtgt acttgtgact      1260
     gattcttctt gtgttatact tagtatttta tattttaatt taaattgctt tgataaataa      1320
     ggccagagtt catgctgatt atgctccaaa aacctttgat atttaggtag tgcctactgg      1380
     gtgccctgtg acgttggcag ccttcttgtt caattgtggc atttgcacaa ccagaagttt      1440
     gaaaaatact gcctataatt ttgaaagcag tagccttctg ctgagcgata ctgacaaatc      1500
     ctaatgaact gtgtctgaag ttgtgtcttc tgctttctgt ccctaaaata acacgcagta      1560
     cctcccaagt ggtattacaa cacatgtttc ttcttgctat aaaattcaag ccctggttca      1620
     tctgtatgca cttcgaatgc tagaagagaa ctgacctctt gttcctgacc tcccagcgtt      1680
     ctcgctcgcc tcccttttca gatgtcacag gagcagatgg gcaacagtca accctggctt      1740
     ttcagttcct cactagggca gtggtgttaa ccgagttgga gtacatgggc taagaacatg      1800
     tttgctgagt ggagctgagc attaaacact aggctaagtc tcagcctctg actggagagt      1860
     gaaaagcact tttagcaagg aaaagaacag tgtagccatg cttggaggac agaagggggg      1920
     tggaatcgtt tttatttggg tctgcttggt ccccgacttt gatgtagtta gcaagccatt      1980
     tcttcctctc atttaagtgc atgcgtttct gagtgtgagt ccatatgcat ccatgtatat      2040
     atgctgtggc atgctgtcag cttactggca attctggagg tcctggagtc tgtgaagaga      2100
     gcttaccaaa tggcagcctc ttgttgtatt ctgcctgtaa aaggtagcat tgaagggagt      2160
     ttaaacaagt cccccatgct ttttcttttc taaagctctt ggcagtgtgg tttttttttt      2220
//


spacer
spacer