spacer

EBI Dbfetch

ID   AK046464; SV 1; linear; mRNA; HTC; MUS; 2014 BP.
XX
AC   AK046464;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230396D21 product:SOMATOSTATIN RECEPTOR TYPE 1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2014
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ee4d70d5bf2da9d382522e38cb93068e.
DR   Ensembl-Gn; ENSMUSG00000035431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110671; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230396D21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2014
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230396D21"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS             426..1601
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="SOMATOSTATIN RECEPTOR TYPE 1 (SWISSPROT|P30873,
FT                   evidence: FASTY, 100%ID, 100%length, match=1173)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q543T0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000586"
FT                   /db_xref="InterPro:IPR001116"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:98327"
FT                   /db_xref="UniProtKB/TrEMBL:Q543T0"
FT                   /protein_id="BAC32742.1"
FT                   /translation="MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNA
FT                   SQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIAD
FT                   ELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPI
FT                   KAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVG
FT                   FVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFV
FT                   ICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCL
FT                   SWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCASRISTL"
XX
SQ   Sequence 2014 BP; 381 A; 595 C; 587 G; 451 T; 0 other;
     gagacatcat tgacttgggg atctgaaggc ctgaaatctc caggtacagg tttaaagaac        60
     tggcaagcag gaaaggagct gctgacgcga tggtgccgct tattaatcat tcatcagtcc       120
     agagcctttc cacttaatgg atgtgccgcg ctgggctcta gcctcttggc ctctcctctc       180
     cactctccag tgtgcccagg acccccggag ctgcaagaga gacagcgctc aagcaagctg       240
     ccgctgggtg atgctcccgg cggcctcagt cggagccgcg ctcgccacag ctgctgcgct       300
     ctgccgggtg gcgccaggcg gcggtgagct gtgagcttgg ggccttgagc ctagggaggg       360
     cgcagacagc aagggcgcaa ggtgagcgcc ccagccggca gccgcaccgg cccacttcag       420
     ctgggatgtt ccccaatggc accgcctcct ctccctcctc ttctccaagc cccagcccag       480
     gcagctgcgg ggaaggagcc tgcagcaggg gtccggggtc cggcgctgcg gacggcatgg       540
     aagagcctgg acgaaacgct tcccagaatg ggaccttaag cgagggacag ggtagcgcca       600
     ttctcatctc tttcatctac tccgtggtat gcttggtggg actgtgtggg aactctatgg       660
     tcatctatgt gatcctgcgc tacgccaaga tgaagaccgc taccaacatc tacattctaa       720
     acctggctat tgctgatgag ctgctcatgc tcagcgtgcc ctttctggtc acttccacgc       780
     tgttgcgcca ctggcccttc ggcgcgctac tttgccgcct ggtgctcagc gtggatgcgg       840
     tcaacatgtt caccagcatc tactgtctga ctgtgcttag tgtggaccgc tatgtggctg       900
     tggtgcaccc gatcaaggca gcgcgctacc gtcggcccac tgtggccaaa gtagtgaacc       960
     tgggcgtgtg ggtcctgtca ttactggtta tcttgcccat cgtggtcttc tcacgcaccg      1020
     cagccaacag cgatggcacg gtagcctgca acatgctcat gcccgagccc gcccagcgct      1080
     ggttggtggg cttcgtctta tacacatttc tcatgggctt cctgctgcct gtcggggcca      1140
     tttgcctgtg ttatgtgctc atcattgcca agatgcgcat ggtggccctc aaggctggct      1200
     ggcagcagcg caagcgctca gagcgcaaga tcactctaat ggtgatgatg gtggtgatgg      1260
     tttttgtcat ctgctggatg cctttctacg tggtacagct ggtcaacgtg ttcgccgagc      1320
     aagacgacgc caccgtgagc cagttgtctg tcatcctggg ctatgccaac agctgtgcca      1380
     accccatcct ctacggcttc ctgtcggaca acttcaagcg ctctttccag cgcatcctgt      1440
     gcctcagctg gatggataac gctgcggagg aaccagtcga ctactatgcc actgccctga      1500
     agagtcgagc ctacagcgtg gaggacttcc agcccgagaa tctggagtct ggaggcgttt      1560
     tccgtaatgg cacctgcgct tccaggatca gcacgctttg aggccgggca ctgccgggag      1620
     ggggggagtg gtcagaaaga tggagctggg aagcgggtgg gagggaatgg taacccgaca      1680
     ccaggtgctg aagtcatagt gcatgacagc gatgcagcgc ccctgcgctg aaccctgttc      1740
     cgctgcgcag gtcagcgggc cagactcttt tcagagtggc tacaagacag tccctaatca      1800
     ccgctctcct ttcgcagagc cttactgtca aggaagcaca gctcgaggat gtctaggcaa      1860
     cttgtctttt ctactctcag agaaggaagg cacattttcc cttgggccct tcctctgctc      1920
     cactccatcc cgagcagagc taggcgctta agaaaaagtt ctgtgccctg atctccagtc      1980
     ttggtatagt accacacata tgcttctttg gagc                                  2014
//


spacer
spacer