spacer

EBI Dbfetch

ID   AK045776; SV 1; linear; mRNA; HTC; MUS; 1352 BP.
XX
AC   AK045776;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230310J16 product:STIP1 homology and U-Box
DE   containing protein 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1352
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 83ecc998a9ed24b067bcdfaf0763c93c.
DR   Ensembl-Gn; ENSMUSG00000039615; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044911; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230310J16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1352
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230310J16"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS             58..972
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="STIP1 homology and U-Box containing protein 1
FT                   (MGD|MGI:1891731 GB|NM_019719, evidence: BLASTN, 99%,
FT                   match=1218)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9WUD1"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1891731"
FT                   /db_xref="PDB:2C2L"
FT                   /db_xref="PDB:2C2V"
FT                   /db_xref="PDB:3Q47"
FT                   /db_xref="PDB:3Q49"
FT                   /db_xref="PDB:3Q4A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUD1"
FT                   /protein_id="BAC32489.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH
FT                   SYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK
FT                   RKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL
FT                   IPNLAMKEVIDAFISENGWVEDY"
XX
SQ   Sequence 1352 BP; 295 A; 360 C; 432 G; 265 T; 0 other;
     gggggctgcg agatctaggt ggccgggcgc ggagcccaag ccgtgccgcg cggcgccatg        60
     aagggcaagg aggaaaagga gggcggcgcg cggctgggca ctggtggcgg cggcagccct       120
     gataagagcc cgagtgcgca agagctcaag gagcagggaa accggctctt cgtgggccgc       180
     aagtacccgg aggcggcggc ctgctacggc cgcgccatca ctcggaaccc acttgtggca       240
     gtgtactaca ctaaccgggc cctgtgctat ctgaagatgc agcagcctga acaggcactt       300
     gctgactgcc ggcgagccct ggagctggac gggcagtctg tgaaggcgca cttcttcctg       360
     gggcagtgcc agctggagat ggagagttat gatgaggcca ttgccaatct gcagcgagcc       420
     tatagtttgg ccaaggagca gcgactcaac tttggggatg atattcctag tgcccttcgc       480
     attgctaaga agaagcgctg gaacagtatc gaggaacggc gcatccacca ggagagtgag       540
     ctgcattcat atctcaccag gctcattgct gctgagcgag agagggaact ggaggagtgt       600
     cagcggaacc acgagggtca tgaagatgat ggccacatcc gggcccagca ggcctgcatt       660
     gaggccaagc acgataaata catggcagat atggatgagc tcttctctca ggtggacgag       720
     aaaagaaaga agcgagatat ccctgactac ttgtgtggca agattagctt tgagctgatg       780
     cgggaaccct gcattacacc cagtggtatc acctatgacc gcaaggacat tgaggagcac       840
     ctgcagcgtg tgggccactt tgaccctgtg acccggagcc ctctgaccca ggaacagctc       900
     atccccaact tggccatgaa ggaagtcatt gacgctttca tctctgagaa cggctgggta       960
     gaggactatt gaggccccat gtcctgcctg gcaccctggc ccaggaggat ctggagacgg      1020
     aagctccagt ccctgtatag tttgtgtccc tgggcctgcc cccatcggcc ctgctgatgg      1080
     gttctgaact gctccccttc tcagcatacc ccttgctgga ccatgagcct cccttgtccc      1140
     ccttctgggc tggagagtgg gtgagggtgg gctgaggttg ctgctgctgc cactgtcctg      1200
     taataaagtc tgtgagcact acattggcat gtgctggtgc agtgggcttg ccagttgcct      1260
     gtctggctag ccaaggaagg tagaaatgaa gacactggtg tccagattga gtgtggcatg      1320
     ccaccaccga tcaggaaaat acagtacctg gg                                    1352
//


spacer
spacer