Dbfetch

ID   AK045495; SV 1; linear; mRNA; HTC; MUS; 2007 BP.
XX
AC   AK045495;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230207D04 product:TAR DNA BINDING PROTEIN homolog
DE   [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2007
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; edf54aae135db7e004b58c5ce1bd63bf.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029129; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029094; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029042; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028831; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028244; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028793; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028942; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028906; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029032; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028933; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029591; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027964; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028324; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000045180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189048; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069263; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0069327; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0069233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069244; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068913; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069740; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069381; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0068853; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0068989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0068889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0069076; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068906; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069924; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068877; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068077; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230207D04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2007
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230207D04"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS             101..997
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="TAR DNA BINDING PROTEIN homolog [Homo sapiens]
FT                   (SPTR|Q96DJ0, evidence: FASTY, 95.8%ID, 100%length,
FT                   match=780)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BLD4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BLD4"
FT                   /protein_id="BAC32395.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPV
FT                   HLISNVYGRSTSLKVVL"
XX
SQ   Sequence 2007 BP; 561 A; 363 C; 465 G; 618 T; 0 other;
     ggtgggcacg gagcggtagc gcggctgttg tcggattcct tcccgtctgt gcttcctcct        60
     tgtgcttcct agcagtggcc tagcggagat ttaagcaaag atgtctgaat atattcgggt       120
     aacagaagat gagaacgatg aacccattga aataccatca gaagacgatg ggacggtgtt       180
     gctgtccaca gttacagccc agtttccagg ggcatgcggc ctgcgctacc ggaatcccgt       240
     gtctcagtgt atgagaggag tccgactggt ggaaggaatt ctgcatgccc cagatgctgg       300
     ctggggcaat ctggtatatg ttgtcaacta tcccaaagat aacaaaagga aaatggatga       360
     gacagatgct tcctctgcag tgaaagtgaa aagagcagtc cagaaaacat ctgacctcat       420
     agtgttgggt ctcccctgga aaacaactga gcaggatctg aaagactatt tcagtacttt       480
     tggagaggtt cttatggttc aggtcaagaa agatcttaaa actggtcact cgaaagggtt       540
     tggctttgtt cgatttacag aatatgaaac ccaagtgaaa gtaatgtcac aacgacatat       600
     gatagatggg cgatggtgtg actgtaaact tcccaactct aagcaaagcc cagacgagcc       660
     tttgagaagc agaaaggtgt ttgttggacg ttgtacagag gacatgactg ctgaagagct       720
     tcagcagttt ttctgtcagt atggagaagt ggtagatgtc ttcattccca aaccattcag       780
     agcttttgcc ttcgtcacct ttgcagatga taaggttgcc cagtctcttt gtggagagga       840
     tttgatcatt aaaggaatca gcgtgcatat atccaatgct gaacctaagc ataatagcaa       900
     tagacagtta gaaagaagtg gaagatttgg tggtaatcca gttcatctca tttcaaatgt       960
     ttatggaaga agcacttcat tgaaagtagt gctgtaaata ttctgccata ggaatacttc      1020
     tgtctacatg ctttctcatc caagaattcg tcatcacgct gcacaggctg cgtctttgac      1080
     gccctgaatg caaagaattc atagcagtta attccccttt ttgacccttt tgagatggaa      1140
     ctttcataaa gtttcttggc agtagtttat tttgcttcaa ataaacttat ttgaaaagtt      1200
     gtctcaagtc aaatggattc atcacctgtc atgcattgac acctgatacc cagacttaat      1260
     tgctatttgt tcttgcattg tccaaagtga aagtttttct ttggtttgtt tttaatttag      1320
     tttttcttaa gtctgggtga ccgcacctaa aatggtaagc agttaccctc tggcttgttc      1380
     tgagtgcctc tgtgcatttg attttctatt tacatgctgt ataaatctcc actggggaat      1440
     catgccttct aaaaatattt gggagagggc aaaagagttg atttctaatg ctttgtagca      1500
     gagcatatca atgggaaaga aggttaagca cctttctgtt tgggatttga aaagtggaat      1560
     taattgcaat agggatgaag tagaagaaac caagaaacca tgtgcctgaa atacattaag      1620
     aagcctgatt gatagcttta agaactagta gggtgggttg tcttacctgt ggcagtctta      1680
     agtgaggtag gcttttgccc tcctgaatgt gggggttatg tagtgatgaa tatgctcaca      1740
     aaatcagatt agactgtcaa tgcattgtta atgtaaaagc aataatacat tgattattgt      1800
     acttttcctg taactactga gaccggaggc gctccttttc taactggaag aatgggacag      1860
     tttttgtgtt ggtagttttt cctaatgccc ttacctaaat agattatgat aaataggttt      1920
     gtcattttgc aagttgcgtg ttttaaaatt ttatatccgt tagagacttg ttatgaacac      1980
     attgtttcat tatacagtat cctctgt                                          2007
//