Dbfetch

ID   AK045456; SV 1; linear; mRNA; HTC; MUS; 2803 BP.
XX
AC   AK045456;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230204D20 product:dopamine receptor 5, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2803
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f232ce5268f170a3b1165e753feea869.
DR   Ensembl-Gn; ENSMUSG00000039358; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029511; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029477; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029427; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029488; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029211; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029942; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028619; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029178; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029325; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029284; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029411; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029314; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029975; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028343; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028700; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000041646; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071448; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071525; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0071441; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071462; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071107; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071940; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071643; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071046; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071184; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071125; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070260; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230204D20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2803
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230204D20"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS             159..1595
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="dopamine receptor 5 (MGD|MGI:94927, evidence: Direct
FT                   assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BLD9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000497"
FT                   /db_xref="InterPro:IPR000929"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:94927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BLD9"
FT                   /protein_id="BAC32378.1"
FT                   /translation="MLPPGRNGTAHRARLGLQRQLAQVDAPGGSAAPLGPAQVVTAGLL
FT                   TLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGY
FT                   WPFGAFCDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAW
FT                   TLSILISFIPVQLNWHRDKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAIS
FT                   SSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRAS
FT                   IKKETKVFKTLSVIMGVFVCCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFV
FT                   WFGWANSSLNPIIYAFNADFRKVFAQLLGCSHLCFRTPVQTVNISNELISYNQDTVFHR
FT                   EIAAAYVHMIPNAVSSGDREVGEEEEAEEEGPFDHMSQISPTTPDGDLAAESVWELDCE
FT                   EEVSLGKISPLTPNCFHKTA"
XX
SQ   Sequence 2803 BP; 601 A; 752 C; 742 G; 708 T; 0 other;
     gaaaggatcc caagcagtgc agggtgagcg cccctcgggt ctggggacgg tcagctgcag        60
     ggccgggagc accctctggg gtgcccgatg gggccttccg cggggcgcag gggcgaagtt       120
     gggatcgcac gcagtgagcc cgagctaccc agcgcgacat gctgcctcct gggcgcaatg       180
     gcaccgcaca tcgggcgcgg ctggggttgc agaggcaact ggcgcaggtg gacgcccccg       240
     ggggctcagc agccccactg ggacccgcgc aggtggtcac cgctggcctc ctgactctct       300
     taatcgtctg gaccttgctc ggcaacgtcc tagtgtgtgc tgctatcgtc cgcagccgcc       360
     acctgcgcgc caaaatgacc aacatcttca tcgtatctct ggccgtctca gacctcttcg       420
     tggcattgct ggtcatgcct tggaaggccg tggctgaggt ggccgggtac tggccctttg       480
     gggcattctg cgacatctgg gtggcctttg acatcatgtg ctccactgct tccatcctga       540
     atctgtgtat catcagcgtg gaccggtact gggctatttc cagacccttc cgctacgagc       600
     gcaagatgac ccagcgtgta gccctggtca tggtggccct ggcctggacc ttgtccatcc       660
     tcatctcctt tatcccggtc caactcaatt ggcacagaga caaggcaggc tcccagggcc       720
     gagagggcct gctgtccaat gagacaccct gggaggaagg ttgggagcta gacgggagaa       780
     cagagaactg tgactccagc ctgaaccgaa cctacgccat ctcctcgtcg ctcatcagct       840
     tctatatccc ggtagccatc atgatagtga cctacacgcg catctaccgc attgcacagg       900
     ttcagatccg ccgtatctcc tccctagaaa gggcagctga gcatgctcag agttgccgga       960
     gccgtggggc ctgcgaacct gaccccagcc tgcgagcatc catcaagaag gagaccaagg      1020
     tcttcaaaac cctgtccgtg atcatggggg tcttcgtgtg ctgctggttg cctttcttca      1080
     tcctgaactg tatggttccc ttctgcagca gtggagatgc ccagggccca aggactggct      1140
     tcccttgtgt cagcgagacc accttcgaca tattcgtctg gtttggctgg gccaactcct      1200
     ctctcaaccc catcatctat gcctttaatg cagacttccg gaaggtgttc gcccagctgc      1260
     tggggtgcag ccacctctgc ttccggaccc ccgtgcagac ggtaaacatc agtaatgaac      1320
     ttatttccta caaccaagac acggtcttcc acagggagat cgctgctgcc tatgtccaca      1380
     tgatcccaaa tgcggtgtcc tccggagaca gggaggtggg agaggaggag gaggcggagg      1440
     aggaggggcc tttcgatcac atgtctcaaa tctctccaac gaccccagat ggtgacctgg      1500
     ctgctgagtc tgtctgggag cttgactgtg aggaggaggt ttccttaggc aaaatctcac      1560
     cactcacccc caattgtttc cataaaactg cttagaaaca ccctcatggg catgtacagt      1620
     tgtggccata tttacaagca tgcacaaatg cgcgcgcaca cgcacacaaa tatacacact      1680
     cctggtgtgc ttatgctttc tgtagtcctg ctgcgtagaa accaaacgat tcttagctga      1740
     gaaaatgaat gagcagaggc tgttggaata aactcagata ttctgggcac agaagagagt      1800
     tccctttaga gacgagaaag tggaacctgg tcctttaaga agtacacctc aatttaccct      1860
     ttctaacaga ggcttgttct gtgacttgca cctgggttgc tttttaaatg acaggtctga      1920
     gtggcaattg ctggtatggt ctgtgacttt ctagactttg ggaccatagc cccctgttct      1980
     cgggctgctg ctttagtgca ggttgaaggg tctttcctgt ggccgggatt tctccctgat      2040
     ttgttgtggt ttccataagc gcacagtaca ttcatttgtg gctgggagga ggggcagtca      2100
     cctttgcttt gccagttggt gctcagtgtt tctcctagag aaaccacaag tgccagtgct      2160
     cttggaagac agcaggattt tggagtacac atttgttttc tgagcagctt tgcttaggga      2220
     actcgcagaa caaagggcct tgaggaaatg ctgacttctt ggatttcttt tttcttagtc      2280
     agtcacacct tcaggacaca ctgacggctc atttcaccta cacagtatta gatgcgggat      2340
     tctcaagcct gagactcaat tacggttgtt tttttttttt tttatctttt ggaactgtct      2400
     tctagaagta taggagacaa tggtcctgct tgctagatag ataccctcgg ctcatgggaa      2460
     agacccccta acataactca tcttctccat ctctcatcta gggtgtttca gagcgacatg      2520
     gcttcagtaa accacaattt ctagggtctt ttagatgtga tatgcttcaa aatgcttcaa      2580
     aaccgaaatc ctgctttgaa gcagacgatt ttctttgcag gccattgcaa atggaatgaa      2640
     cttcagccta tatatgcaga aagccagagg caacacatgc ctggatgaac ttgcagggtt      2700
     aggggctcac ggaggagccc acctgtcttt ttgctttccc accctgcact gagtacggtg      2760
     aagtgtcctt tattctggta tgatttttat tagacacaaa tgt                        2803
//