Dbfetch

ID   AK045364; SV 1; linear; mRNA; HTC; MUS; 2578 BP.
XX
AC   AK045364;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230106O20 product:5-HYDROXYTRYPTAMINE 1F RECEPTOR
DE   (5-HT-1F) (SEROTONIN RECEPTOR) (5-HT-1E-BETA), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2578
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8bd0bb0d6bccdfcf2bebe7fe1db5a8c0.
DR   Ensembl-Gn; ENSMUSG00000050783; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022943; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022911; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022881; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022913; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022675; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023361; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022198; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022646; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022778; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022752; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022847; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022771; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023377; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021941; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022245; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000063076; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0044842; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0044823; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0044795; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0044800; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0044539; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045282; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0044658; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0044453; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0044604; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0044553; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0044678; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0044533; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045336; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044236; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0043908; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230106O20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2578
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230106O20"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS             380..1480
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5-HYDROXYTRYPTAMINE 1F RECEPTOR (5-HT-1F) (SEROTONIN
FT                   RECEPTOR) (5-HT-1E-BETA) (SWISSPROT|Q02284, evidence:
FT                   FASTY, 100%ID, 100%length, match=1098)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q543V2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000450"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99842"
FT                   /db_xref="UniProtKB/TrEMBL:Q543V2"
FT                   /protein_id="BAC32328.1"
FT                   /translation="MDFLNASDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVI
FT                   AAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDI
FT                   ICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFWRH
FT                   QGTSRDDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIK
FT                   EELNGQVFLESGEKSIKLVSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQ
FT                   KISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNS
FT                   LINPLIYTIFNEDFKKAFQKLVRCRY"
FT   regulatory      2563..2568
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2578
FT                   /note="putative"
XX
SQ   Sequence 2578 BP; 809 A; 514 C; 502 G; 753 T; 0 other;
     gaagacactg ggaggggagg aaaagtggaa gaagctagaa gagcgaggtg ctgaggtgat        60
     ccccggggcg tcggccctcg agtggactgg cgtctggaac ccgccctaga gctgcgcccc       120
     aagctgcagc gcgcattcag ctcgccaccc aagagcagcc gggacgcgct gttgtcgcca       180
     gagaacgacc gcggcgggct agggaccaga gccccttagc ttcgctctgg ggaagctgag       240
     ttgagatggc attgaactgt gaatggctga ctaatttctc accagatcag gaggtgaagt       300
     gagaatgaag accaacagtt gagcctgcca caccacggta ttcatttctt caactatatt       360
     aacattttaa caaaaaaaaa tggatttttt aaacgcatca gaccaaaact tgacctctga       420
     ggaactgtta aaccgaatgc catccaaaat tctggtatcc ctcactctgt ctgggctggc       480
     attgatgaca accaccatca actccctcgt gatcgctgcg atcattgtga ctcggaagct       540
     gcaccaccca gccaactatt taatttgttc cttggcagtt acagattttc ttgtagctgt       600
     cctggtgatg cccttcagta ttgtgtacat tgtgagagag agctggatta tgggacaagt       660
     actctgtgac atttggctga gtgtcgacat catctgttgt acgtgttcca tcttgcatct       720
     gtcggctata gccttggata ggtaccgcgc catcacagat gcagttgaat acgccaggaa       780
     gaggactccc aggcatgccg gcatcatgat cacgatcgtg tgggttatat ctgtgttcat       840
     ctctatgcct cctctcttct ggaggcacca aggaactagc cgtgatgatg agtgtgtcat       900
     caaacatgac cacattgttt ccacaattta ctccacgttt ggagctttct acatcccgct       960
     tgtattgata ttgatcctct actacaaaat atacagagca gcaaggacac tgtaccacaa      1020
     gagacaagcg agtcggatga taaaggagga gctgaacggt caagtcttct tggagagcgg      1080
     tgagaagagc attaaactgg tctccacatc ctacatgtta gaaaaatcct tgtccgatcc      1140
     atcaacggac tttgatagaa ttcacagcac cgtgaaaagt cccagatcgg aactgaagca      1200
     tgagaaatct tggagaagac agaaaatctc aggcaccaga gaacgcaaag cagccactac      1260
     cctgggattg atcttgggtg catttgtaat atgttggctg cccttttttg taaaagaatt      1320
     ggttgttaat gtctgtgaaa aatgtaaaat ttctgaagaa atgtcaaact ttttggcatg      1380
     gcttggttac ctgaattccc ttataaatcc actgatttat accatcttta atgaagactt      1440
     caagaaagct ttccaaaaac ttgtacgatg ccgatattag gataaaagaa acctaatttt      1500
     aaagtgcgga ggctttattt gttgggggga ggggcaggga taattaaatg aatgtaaagt      1560
     aagaaaacat ttaaattttt agagaaaata tattaaaact gctaaaatta taagaggata      1620
     aatttatttt taatagcacc aagaaaataa gatgtattca tttggccata attttaatgt      1680
     tctcaagatt aggaaataat ttatgcagct cagctcgtaa tattttgtct atgcaatata      1740
     cctaagaagc taactagaaa tacatatata taataattga taatatatgc atatatatta      1800
     tcaattacaa tgctttccag gtttatatgt tacaacaact agagacattt ttaactagca      1860
     tctttccact ggtaatttct gtcacctcat tgcttaacca ctatttatag aaaaatattc      1920
     aatgtaatgc tactattgcc ccttctccat cttctccact acaaaggtgg agatatagca      1980
     acagcagctc ctatttagcc ttagcagaga agatatgaag ctcagcggct ttgatagtgt      2040
     cctcacattt ggacagtaaa aataatcatc caatgagcta gatatgggaa atatttcaat      2100
     atcctgcatt ttctgcacat ttgcaatctt tacttatttt gatatcaagt tctagaataa      2160
     tattatctta accatatatc tgtatttaaa atcaaagccc caaggttaga ggaaaggttt      2220
     attatgcaat tactgtataa ttgttatata cattgccccc tgtctaggaa tcaagctcta      2280
     aacactaagg accttaacta actcactgta attaacatac ttctagtgta aattttattt      2340
     ttctccacca atattattag gtccagtttt tataactcat ctccatatct taagatctga      2400
     acatcatttc ttttttatta cagagaatat aataaaaaac ttaaaacttt gctttgactt      2460
     tataaaaaaa agtttttcct attataatta ggacaccttt cacaaatcaa gaccatttga      2520
     aaaacaacgt atttgaaaaa cgacacatac atttgaaatg taaataaaga aaatatct        2578
//