Dbfetch

ID   AK045259; SV 1; linear; mRNA; HTC; MUS; 2394 BP.
XX
AC   AK045259;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 9.5 days embryo parthenogenote cDNA, RIKEN full-length
DE   enriched library, clone:B130052F17 product:hypothetical
DE   Immunoglobulin-like/Immunoglobulin C-2 type/Immunoglobulin subtype/Ig-like
DE   domain profile containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2394
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4291de60b564abe7c3a6383ca7b385d2.
DR   Ensembl-Gn; ENSMUSG00000020598; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019712; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019676; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019647; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019654; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019458; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020101; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019011; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019430; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019543; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019532; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019613; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019568; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020141; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018778; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019061; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110748; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034773; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0034698; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0034682; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034696; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034476; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035195; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034398; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0034390; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0034533; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0034524; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0034672; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034534; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035243; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034079; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033940; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B130052F17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2394
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="9.5 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B130052F17"
FT                   /tissue_type="parthenogenote"
FT                   /db_xref="taxon:10090"
FT   CDS             244..1023
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Immunoglobulin-like/Immunoglobulin C-2
FT                   type/Immunoglobulin subtype/Ig-like domain profile
FT                   containing protein (InterPro|IPR007110 InterPro|IPR003598
FT                   InterPro|IPR003599 PROSITE|PS50835, evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q810U4"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026966"
FT                   /db_xref="MGI:MGI:104750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810U4"
FT                   /protein_id="BAC32284.1"
FT                   /translation="MQLKIMPKKKHLSAGGVPLILFLCQMISALDVPLDLVQPPTITQQ
FT                   SPKDYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTLVINIMS
FT                   EGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKERLEPIVLQNGQSLVLPCRP
FT                   PIGLPPAIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTI
FT                   QQKQPISLKVISVDELNDTIAANLSDTEFYGGELQWL"
XX
SQ   Sequence 2394 BP; 683 A; 507 C; 455 G; 749 T; 0 other;
     gactcggctt aaggttttct ttttgccact gggaggaata ggaagcagtg caatatcttc        60
     atttttaaga gcaatgctaa gaaaaccttt ggcttaagga attaaaacga aataccactt       120
     cttcaagtaa gaagacctac ttcaaagtcc cctgcatgaa aaattattta aacgccgcac       180
     accaatcttc cgtgagagaa gaaaaggaaa ttccgtgcgt gggtctcagc aggagtgcag       240
     ctgatgcagc ttaaaataat gccgaagaag aagcacttat ctgcaggcgg agtgcccctg       300
     attctcttcc tgtgccagat gatcagcgcg ctggatgttc ctctcgatct ggtacaacct       360
     ccaaccatca ctcaacagtc accaaaagac tacatcattg accctcggga gaatattgta       420
     atccagtgtg aggccaaagg gaaacctccc ccaagctttt cctggactcg taatggaact       480
     cactttgaca tagacaagga ccctctggtc accatgaagc ctggctcagg aacccttgtc       540
     atcaacatca tgagtgaggg gaaggcagag acctatgaag gagtctacca gtgcactgca       600
     aggaacgagc gtggagctgc cgtctccaat aacattgttg tccgcccatc taggtcaccc       660
     ttgtggacca aggaaagact tgaacctata gtactccaga atgggcagtc attagtactt       720
     ccatgtaggc ctccgattgg attacctccg gccataatat tttggatgga taattccttt       780
     cagagacttc cacagagtga gcgggtttcc caaggcctaa atggagacct ttacttctcc       840
     aatgtcctcc cagaggacac ccgtgaggac tatatctgct atgccagatt taatcacact       900
     caaaccatcc agcagaagca gcctatttct ttgaaggtga tttcagtgga tgaattgaat       960
     gacactatag ctgctaattt gagtgacact gagttttatg gtggtgagtt acagtggttg      1020
     taaccgatat tctcctcctt cattgtagac tttagttcac taacttcacc tccatggcca      1080
     cttaaccttg tttctttggg aaatttctag ttccatgttt aacatcactg tatcaatgtg      1140
     tgtttcttaa gaaactgagc tgtaaacctt caagcatgtc cctgaaacat tttccatggt      1200
     gtatgtatag ttaaacttgc tataaagttt cgtgtaagcc atttcatatg ctttagaaaa      1260
     aaatctgtca tatgtgatta taattatatt tttcatactt tgtgctgtct ataaactttt      1320
     tgcatggcct acaatataaa ctgattggtc gtattaaccc ctagagcatc attagaacct      1380
     tcagtaacta acatagagta cattccgtag taatcctcta accttcctta agtttttcat      1440
     gtcattattc agcagaatta gcaaccgtgt tgtgttgctt ttagctttgt tagaaaccta      1500
     atcaccgttt tctgcgggag gaaacttttc aaaatagatc agtcaacttc attgtattaa      1560
     actgaaacaa attggatttc cttaaggctg tcaagcataa aatctgtcac taaacaatat      1620
     ggctctttat tccccataga tggagtttct gctacattag tttttacctt tgaggtatga      1680
     acattgcaga atatggcaga tataatctca tctttattta ttgaatatag ttcttccaaa      1740
     tatgggcctc aagactcttg tcaaggtgat ttttacagga gtaaggtccc ctaacaactt      1800
     ctaaaatcct taggaaaaca atattttctc cagcaatact attttggggt cgttagattt      1860
     ttctttggag aaatgagaag tttacccagt gccttttcat tgggttttag aagcatcaag      1920
     tgcgtcattt gtggttgaag cagtgaaaag tcttatgaca tttccacttg aaaatttccc      1980
     caggccttta gtagataagg tcacatgttt taaaagtcca caaaacagaa ggtgtcttgt      2040
     ttaactattt ctaagctctc tgatttagac cttctttatt ttgtcattgg ataaaatgat      2100
     ttccatgtgt tcggctctgc cgctaactct tttctttttt tccaaagcta gggacgaagc      2160
     ccagggcctg accaatacta aacaacactc tgccatgaag ccactccttc agctcctcta      2220
     ctgtaaatct gtattcagag catataattt cccagaactc tttagaaatt ctccagtttt      2280
     gttttatttt tcataaacct tgcagtgtag gaattttgag atataggtta gtggcaaggg      2340
     ctataatgct atgtccagaa taaatcaaaa tactttgtcc ataatgattt gccg            2394
//