Dbfetch

ID   AK044850; SV 1; linear; mRNA; HTC; MUS; 2718 BP.
XX
AC   AK044850;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 9.5 days embryo parthenogenote cDNA, RIKEN full-length
DE   enriched library, clone:B130008A04 product:insulin-like growth factor 2,
DE   binding protein 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2718
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ac917593420753e26a97adf13d849b64.
DR   Ensembl-Gn; ENSMUSG00000013415; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013559; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B130008A04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2718
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="9.5 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B130008A04"
FT                   /tissue_type="parthenogenote"
FT                   /db_xref="taxon:10090"
FT   CDS             217..1950
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="insulin-like growth factor 2, binding protein 1
FT                   (MGD|MGI:1890357 GB|NM_009951, evidence: BLASTN, 98%,
FT                   match=2224)"
FT                   /note="putative"
FT                   /db_xref="GOA:O88477"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1890357"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88477"
FT                   /protein_id="BAC32119.1"
FT                   /translation="MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCP
FT                   DEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQY
FT                   GTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQITQGP
FT                   ENGRRGGFGSRGQPRQGSPVAAGAPAKQQPVDIPLRLLVPTQYVGAIIGKEGATIRNIT
FT                   KQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKI
FT                   LAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAE
FT                   QEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSF
FT                   MQAPEQGMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVVITG
FT                   PPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLT
FT                   AAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNLAQARR
FT                   K"
XX
SQ   Sequence 2718 BP; 683 A; 765 C; 730 G; 540 T; 0 other;
     gacttctccc gggctcaccc aaactctccc gtgacccccg cgtgccctca ggccgcccac        60
     ccgcccggag ctccggacaa cttcaggggt ggggtgcgta gaaagtttgc ggctcccgcc       120
     gcccgtctcc acgcctctcg gcctaggagg ctctccgccc gcgcccgccc ggctcggcct       180
     tgcctggaac cgtgtccttg ccccgccacc gccaccatga acaagcttta catcggcaac       240
     ctcaacgaga gtgtgacccc cgcagacttg gagaaagtat tcgcggagca caagatctcc       300
     tacagcggcc agttcttggt caaatccggc tacgccttcg tggattgccc cgacgagcac       360
     tgggcgatga aggccatcga aactttctcg gggaaagtag aactgcaagg aaaacgtcta       420
     gagattgaac actcagtccc caaaaaacaa aggagtcgga aaatacagat ccgcaatatt       480
     ccacctcagc tccgatggga agtgctagat agcctgctgg ctcagtacgg tacagtggag       540
     aactgtgagc aagtgaacac tgaaagtgag acagctgtgg tcaacgtcac ctactctaac       600
     cgggagcaga ccaggcaagc tatcatgaag ctaaatggcc atcaactgga gaaccatgcc       660
     ctgaaggtct cctacatacc tgatgagcag ataacgcaag gtcctgagaa tgggcgtcgt       720
     ggaggctttg ggtctcgggg ccagccccgg caagggtcgc ccgtggcagc aggggctcca       780
     gccaagcagc agccagtgga catccctctc cggctcctgg tgcctacgca gtatgtaggc       840
     gctatcattg gcaaggaggg tgccaccatc cgaaacatca caaaacagac gcagtccaaa       900
     atagacgtgc ataggaagga gaatgcgggc gctgcggaga aggccatcag cgtgcattca       960
     acccctgaag gctgctcctc cgcgtgcaag atgatcttgg agattatgca caaggaggca      1020
     aaggacacca aaacggcaga tgaagttccc ctgaagatcc tggctcataa caacttcgtc      1080
     gggcgactca ttggcaagga agggcggaac ctgaagaagg tggagcagga cacagagacg      1140
     aagatcacca tctcatcgct ccaggacctc acgctctata accctgagag gaccatcact      1200
     gtgaagggcg ccattgagaa ctgttgcagg gccgagcagg agatcatgaa gaaagttcga      1260
     gaggcttacg agaacgacgt ggccgccatg agcttgcagt cccacctcat ccctgggctt      1320
     aacctggctg ctgtaggtct cttcccagct tcatccagcg ctgtccctcc tcctcccagc      1380
     agtgtcaccg gggctgctcc ctatagctcc ttcatgcagg ctccggagca ggggatggta      1440
     caagtgttca tccccgccca ggctgtgggc gccatcattg gcaagaaggg ccagcacatc      1500
     aaacaactct cccgcttcgc cagcgcctcc atcaagattg caccaccaga aacacctgac      1560
     tccaaagttc gaatggtcgt catcactgga cccccagagg ctcagttcaa ggcccaggga      1620
     agaatctatg gcaaactaaa agaagagaat ttctttggtc ccaaggagga agtaaagcta      1680
     gagacccaca tacgggttcc ggcttcagca gccggccgtg tcatcggcaa aggcggcaaa      1740
     acggtgaatg agctgcagaa cttgaccgca gctgaggtgg tagtgccaag agaccagacc      1800
     ccggatgaga acgaccaagt cattgttaag atcatcggac atttctatgc cagccagatg      1860
     gctcagcgga agatccgaga catcctggct caagttaagc aacagcacca gaagggacag      1920
     agcaacctgg cccaggctcg gaggaagtga ccccgccccc tcctgtccca ttggctccaa      1980
     gatcagcagg aggaacacag aactggaggg gcgggtggag ggccggtgtg ctcttcccag      2040
     caggcctgag aatgagtggg aatcagggca tttgggcctg gctggagatc aggtttgcac      2100
     actgtcttga gaacaatgtt ccagtgagga atcctgatct ctcgccccca attgagccag      2160
     ctggccacag cccacccctt ggaatatcac cattgcaatc atagcttggg ttgcttttaa      2220
     acgtggattg tcttgaagtt ctccagcctc catggaagga tgggtcagat cccagtgggg      2280
     aagagaaata aaatttcctt caggttttat aaaacctcaa aggatggttt gtttcttaac      2340
     ccctccaaat ctttctaacc ttcttggtta attcacgaaa attcctcccg ttcttaatgt      2400
     cctgaccagt aacttacctc ttcctggatc cattcacact gtttcagcct tgttgtgctg      2460
     gggtggggga ggggcgggag gagggctaga acacagcttt gtttacaata ttaactctgg      2520
     agagccctat cctggatagt ctaattctga tttttcctta accaaccatt aggaacagca      2580
     agatataaag gagagagtta ataattacag tatgtaccga tccacgttta aaaggagtcc      2640
     ttgggctaag gatagagctc gccgggcaca gtgcttgccc ggcacggacg aggccctggc      2700
     ttctatcctt ggcatcac                                                    2718
//