spacer

EBI Dbfetch

ID   AK044695; SV 1; linear; mRNA; HTC; MUS; 2560 BP.
XX
AC   AK044695;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 16)
XX
DE   Mus musculus adult retina cDNA, RIKEN full-length enriched library,
DE   clone:A930034B14 product:calcium channel, voltage-dependent, alpha 1F
DE   subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2560
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 083daa0c250b365fb7c973243321e5dd.
DR   Ensembl-Gn; ENSMUSG00000031142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133637; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A930034B14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2560
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A930034B14"
FT                   /tissue_type="retina"
FT                   /db_xref="taxon:10090"
FT   CDS             28..>2560
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="calcium channel, voltage-dependent, alpha 1F subunit
FT                   (MGD|MGI:1859639 GB|NM_019582, evidence: BLASTN, 99%,
FT                   match=2394)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8C8Q4"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005446"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR030157"
FT                   /db_xref="MGI:MGI:1859639"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C8Q4"
FT                   /protein_id="BAC32037.1"
FT                   /translation="MSESEVGKDTTPEPSPANGTGPGPEWGLCPGPPTVGTDTSGASGL
FT                   GTPRRRTQHNKHKTVAVASAQRSPRALFCLTLTNPIRRSCISIVEWKPFDILILLTIFA
FT                   NCVALGVYIPFPEDDSNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGW
FT                   NLLDFIIVVVGLFSVLLEQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPS
FT                   LHIVLNSIMKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPS
FT                   PCASSGSGRSCTLNHTECRGRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQ
FT                   DAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEE
FT                   DLRGYLDWITQAEELDLHDPSVDGNLASLAEEGRAGHRPQLSELTNRRRGRLRWFSHST
FT                   RSTHSTSSHASLPASDTGSMTDTPGDEDEEEGTMASCTRCLNKIMKTRICRHFRRANRG
FT                   LRARCRRAVKSNACYWAVLLLVFLNTLTIASEHHGQPLWLTQTQEYANKVLLCLFTVEM
FT                   LLKLYGLGPSVYVASFFNRFDCFVVCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKV
FT                   TRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTF
FT                   DTFPQALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCVYFIILFICGNYILLNVF
FT                   LAIAVDNLASGDAGTAKDKGREKSSEGNPPKENKVLDLNWFPDPCQVDHNYLQLQVQEI
FT                   QCLWPPDLKSHLHSHTHTHTWILVIENNKAKS"
XX
SQ   Sequence 2560 BP; 566 A; 723 C; 666 G; 605 T; 0 other;
     ggatggtcct tatatctcct gaggaggatg tcggaatctg aagtcgggaa agatacaacc        60
     ccagagccca gtccagccaa tgggactggc cctggccctg aatgggggct ctgtcctggg       120
     cctccaactg tggggactga taccagcggg gcgtcaggcc tggggacccc aagaagaagg       180
     acccagcaca acaaacacaa gactgtggcg gtggccagtg ctcagagatc acctcgagcg       240
     ctcttctgcc tcacccttac taatcccatt cgtcggtcct gcatcagcat tgtagagtgg       300
     aagccttttg atattctcat cctcctgaca atctttgcca actgcgtggc attgggggta       360
     tatatcccct tccctgagga cgactccaac actgctaacc acaacttgga acaggtagaa       420
     tacgtgttcc tggtgatttt caccgtggag acagtgctca agatcgtagc ctatgggctg       480
     gtgctccatc ccagcgccta tattcgcaat ggctggaacc tgctcgactt catcatcgtc       540
     gtggtcgggc tgttcagcgt gctgctggaa caaggacctg ggcggccagg agatgccccg       600
     catactggag gaaagccagg aggcttcgat gtaaaggcac tgcgggcatt tagggtgcta       660
     cgacctctaa ggctagtgtc tggggtcccg agtctgcaca tagtgctcaa ttccatcatg       720
     aaggcgcttg tgccgctgct gcacattgcc ctgttggtgc tcttcgtcat tatcatttac       780
     gccatcatcg gactcgagct attcctcgga cgaatgcaca agacatgcta cttcctggga       840
     tctgatatgg aagcagagga ggacccatca ccttgtgcat cttctggctc tgggcgttca       900
     tgcacactga accataccga gtgccgcggg cgctggccag gacccaacgg tggcatcacg       960
     aacttcgaca attttttctt tgccatgcta actgtgttcc agtgtattac catggaaggc      1020
     tggacagacg tcctctactg gatgcaggat gccatggggt atgagctgcc ttgggtgtac      1080
     tttgtgagcc ttgtcatctt tgggtccttc tttgtcctca accttgtgct tggagtccta      1140
     agcggggagt tctccaagga aagagaaaag gcaaaagcac gaggtgactt tcagaagctt      1200
     cgggagaagc agcagatgga agaagacctt cggggctacc tggactggat cacacaggct      1260
     gaggagttag accttcatga cccctcagta gacggcaact tggcttctct tgctgaagag      1320
     ggacgggcgg gccatcggcc acaactgtca gagctgacca ataggaggcg cggacggctg      1380
     cgatggttca gccactctac tcgctccaca cactccacca gcagccacgc cagcctccca      1440
     gccagtgaca ctggctccat gacagacacc cctggagatg aggatgaaga agaggggacc      1500
     atggctagct gtacacgctg cctaaacaag attatgaaaa caaggatctg ccgccacttc      1560
     cgccgagcca accggggtct ccgtgcacgc tgccgccggg ccgtcaagtc caacgcctgc      1620
     tactgggctg tactgttgct cgtcttcctc aacacgttga ccatagcttc agagcaccat      1680
     gggcagcctt tgtggctcac ccagacccaa gagtatgcca acaaagttct gctctgcctc      1740
     ttcactgtgg agatgctcct caaactgtac ggcctgggcc cctctgtcta cgttgcctcc      1800
     tttttcaacc gctttgactg cttcgtggtc tgtgggggca tcctagaaac cactttggtg      1860
     gaggtggggg ccatgcagcc tcttggcatc tcagtgctcc gatgtgtacg tctcctcagg      1920
     atcttcaagg tcaccaggca ctgggcatcc ctgagcaatc tggtggcatc tttgctcaat      1980
     tccatgaagt ccatcgcctc cttgctgctt ctcctctttc tcttcatcat catcttctcc      2040
     ctgcttggca tgcagctgtt tgggggcaag ttcaactttg accagaccca caccaagagg      2100
     agcacctttg ataccttccc ccaagccctc ctcactgtct ttcagatcct gactggtgag      2160
     gattggaacg ttgtcatgta tgatggtatc atggcctacg gtgggccctt cttcccaggg      2220
     atgctggtgt gtgtttattt catcatcctc ttcatctgtg gcaactacat cctgctgaac      2280
     gtgtttcttg ccattgccgt ggataaccta gccagcgggg atgcaggcac tgccaaagac      2340
     aagggcagag agaagagcag tgaaggaaac cctccaaagg agaacaaagt attggacctg      2400
     aattggttcc cagacccgtg tcaagtggat cacaactacc tgcaactcca ggtccaggag      2460
     atccaatgcc tctggcctcc agacctcaag agtcacctgc attcacatac acatacccac      2520
     acatggatac ttgtaattga aaataataaa gctaaatcct                            2560
//


spacer
spacer