Dbfetch

ID   AK043806; SV 1; linear; mRNA; HTC; MUS; 2092 BP.
XX
AC   AK043806;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 10 days neonate cortex cDNA, RIKEN full-length enriched
DE   library, clone:A830035D19 product:gamma-aminobutyric acid (GABA-A)
DE   receptor, subunit alpha 4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2092
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9d80bb95d5b2d0e377f57f12a1ca5ad8.
DR   Ensembl-Gn; ENSMUSG00000029211; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029608; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029576; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029524; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029585; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029308; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030039; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028716; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029277; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029423; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029383; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029508; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029411; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030072; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028440; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028796; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031121; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072023; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0072107; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0072021; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072038; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071678; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072507; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072222; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071631; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071768; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071818; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071693; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072710; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071693; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070828; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A830035D19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2092
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A830035D19"
FT                   /tissue_type="cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             118..1776
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid (GABA-A) receptor, subunit
FT                   alpha 4 (MGD|MGI:95616, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q543Z0"
FT                   /db_xref="InterPro:IPR001390"
FT                   /db_xref="InterPro:IPR005434"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95616"
FT                   /db_xref="UniProtKB/TrEMBL:Q543Z0"
FT                   /protein_id="BAC31659.1"
FT                   /translation="MVSVQKVPAIALCSGVSLALLHFLCLAACLNESPGQNSKDEKLCP
FT                   ENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWI
FT                   DKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYT
FT                   MRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLV
FT                   QYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWIN
FT                   KESVPARTVFGITTVLTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAV
FT                   NYFTNIQMQKAKKKISKPPPEVPAAPVLKEKHTETSLQNTHANLNMRKRTNALVHSESD
FT                   VKSRTEVGNHSSKTSAVQESSEATPKAHLASSPNPFSRANAAETMSAAARGLSSAASPS
FT                   PHGTLRPASLGSASTRPAFGSRLGRIKTTVNTTGAAGNVSATPPPPAPPPSGSGTSKID
FT                   KYARILFPVTFGAFNMVYWVVYLSKDTMEKSESLM"
XX
SQ   Sequence 2092 BP; 598 A; 462 C; 462 G; 570 T; 0 other;
     gcggagcgcg agtgtgcgca cgccgcggga gccactctgc cctctcctcg caccctgccc        60
     agggcatctc gagaggctgg aaacgtgaac aggcttaaag tatggcatgt tgcgaagatg       120
     gtttctgtcc agaaggtacc cgcgattgcg ctgtgctccg gggtcagcct cgccctcctg       180
     cacttcctgt gcctggcggc ttgtttaaac gaatccccag gacagaactc aaaggacgag       240
     aaattgtgcc cggaaaattt tacccgtatt ctggacagtt tgctggatgg ttatgacaac       300
     aggctgcgtc ctggatttgg gggtcctgtt acagaagtga aaactgatat atatgtcacc       360
     agctttgggc ccgtttctga tgttgaaatg gaatacacta tggatgtgtt cttcagacag       420
     acatggattg acaaaagact aaaatatgac ggcccaattg aaatcttgag gctgaataat       480
     atgatggtca ccaaagtttg gacccctgat actttcttca ggaatggaaa gaaatctgtc       540
     tcacataaca tgacagctcc aaataagctt tttagaatta tgagaaatgg cactatttta       600
     tacacaatga gactcaccat aagtgcggag tgccccatga gactggtgga ttttcctatg       660
     gatggtcatg cctgcccttt gaaatttggg agttatgcat atcccaaaag tgagatgatc       720
     tacacctgga ccaaaggccc tgagaagtca gtggaggtgc caaaggagtc ttctagctta       780
     gttcaatatg acctcattgg gcagactgta tcaagcgaga ctatcaaatc tattacaggt       840
     gaatacattg ttatgacggt ttacttccac ctcagacgga agatgggcta ctttatgatt       900
     cagacgtata tcccatgcat catgacagtg attctttctc aagtttcctt ctggataaac       960
     aaggagtctg ttccagctag aactgtattt ggaataacca cagtcctcac gatgaccacc      1020
     ctaagcatca gtgctcggca ttctttgccc aaagtgtcct atgcgactgc catggattgg      1080
     ttcatagctg tctgttttgc ttttgtattt tcggctctta ttgagtttgc tgctgtcaac      1140
     tatttcacca acattcaaat gcagaaagcc aaaaagaaga tatcaaagcc tcccccagaa      1200
     gttccagctg ctcctgtgct gaaggagaaa cacacagaaa catcccttca gaatacacat      1260
     gccaatttga acatgaggaa aagaacaaat gccttggtcc attcagaatc ggatgtcaaa      1320
     agcagaactg aggtgggaaa tcactccagc aagaccagcg ctgtccagga gtcttctgaa      1380
     gccacgccta aggctcactt agcttccagt ccaaatccat tcagcagggc aaatgcagct      1440
     gagactatgt ctgctgcagc cagaggtctt tcatctgcag catccccctc tcctcatggc      1500
     acattgcggc cagcttcttt ggggtcagct tccactcgcc ctgcatttgg atctagactt      1560
     gggcgaatta agacaacagt taatacaaca ggggctgctg ggaatgtgtc agccacacct      1620
     cctccccctg ctccaccgcc ttctggatct ggcacaagta aaatagacaa atatgctcgt      1680
     attctctttc cagtcacatt tggagcattt aacatggtct actgggttgt ttatttatct      1740
     aaggacacca tggagaaatc agaaagtcta atgtaatttt gttgctatag taatttcata      1800
     acaacgatgg aaatacagac tgtcttttaa aatgttttta aaggtaagta ttctttacta      1860
     aaataaaaat tctatgtaat tttttcactt aaaaaaatac aagtcagata tggagagagt      1920
     taattaactc ttcagtggct agaaagtgaa ccatctttct ttatagaaag atagctttaa      1980
     aagaatctat tcagtgttca aattggatag aacacagagc attatggaaa gttggagcaa      2040
     gagaaataga gctaggagag atatgtggta cacccttttg cattgaaatt cg              2092
//