Dbfetch

ID   AK043668; SV 1; linear; mRNA; HTC; MUS; 3113 BP.
XX
AC   AK043668;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 10 days neonate cortex cDNA, RIKEN full-length enriched
DE   library, clone:A830017H24 product:5-HYDROXYTRYPTAMINE 1A RECEPTOR (5-HT-1A)
DE   (SEROTONIN RECEPTOR) (5- HT1A), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3113
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4196f502f6f4633a48f9cbc71b7d565f.
DR   Ensembl-Gn; ENSMUSG00000021721; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020915; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020866; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020841; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020866; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020655; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021300; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020174; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020617; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020741; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020723; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020815; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020751; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021339; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019927; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020232; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022235; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038095; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038040; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038005; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038052; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037802; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038510; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037775; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037713; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0037857; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0037822; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037976; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037813; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038564; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037414; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037206; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A830017H24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3113
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A830017H24"
FT                   /tissue_type="cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             21..1286
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5-HYDROXYTRYPTAMINE 1A RECEPTOR (5-HT-1A) (SEROTONIN
FT                   RECEPTOR) (5- HT1A) (SWISSPROT|Q64264, evidence: FASTY,
FT                   99.5%ID, 100%length, match=1263)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q64264"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000610"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64264"
FT                   /protein_id="BAC31611.1"
FT                   /translation="MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGT
FT                   LIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTL
FT                   GQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLI
FT                   GFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAA
FT                   RFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAV
FT                   RQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARE
FT                   RKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVI
FT                   YAYFNKDFQNAFKKIIKCKFCR"
XX
SQ   Sequence 3113 BP; 704 A; 805 C; 777 G; 827 T; 0 other;
     gagcgggagt gcaggcaggc atggatatgt tcagtcttgg ccagggcaac aacaccacaa        60
     cgtccctgga gcccttcggg acaggcggca acgatactgg cctctccaac gtgaccttca       120
     gctaccaagt gatcacctct cttttgctgg ggacgctcat tttctgcgcg gtgctcggca       180
     atgcctgcgt ggttgctgcc atcgccctgg agcgctccct tcagaatgtt gccaactatc       240
     tcatcggctc cttggcggtc accgatctca tggtgtcagt gctggtgctg cccatggctg       300
     ctctgtacca ggtgctcaac aagtggactc tgggtcaggt cacctgtgac ctgtttatcg       360
     ccctggatgt gctgtgctgc acttcgtcca tcctgcacct gtgcgccatc gcgctagaca       420
     ggtactgggc aatcaccgac cctatagact acgtgaacaa gaggacgccc cggcgcgccg       480
     ctgcgctgat ctcgctcact tggctcattg gctttctcat ctccatcccg cctatgctgg       540
     gctggcgcac cccggaagac cgctcgaacc ccaacgagtg caccatcagc aaggaccacg       600
     ggtacaccat ctactccact ttcggcgctt tctatattcc gctgctgctc atgctggtcc       660
     tctatgggcg catcttcaga gccgcgcgct tccgaatccg caagacggtc aagaaggtgg       720
     aaaagaaggg agcgggcacc agcttcggaa catcgtcggc cccgcccccc aagaagagcc       780
     tgaatggtca gccaggtagt ggggactgca ggcgcagtgc tgagaacagg gcggtgggga       840
     ctccgtgcgc taatggggcg gtgagacagg gtgaggacga cgccaccctg gaggtgatcg       900
     aggtgcatcg agtgggcaac tccaaagggc accttcctct gcccagcgaa tcaggagcta       960
     cctcctatgt ccccgcctgc ttggagagaa aaaatgagcg cactgctgag gcaaagcgca      1020
     agatggcctt ggcccgtgag aggaagacag tgaagacact gggcatcatc atgggcacct      1080
     tcatcctctg ctggctgccc tttttcattg tggccctggt cctacctttc tgtgagagca      1140
     gttgccacat gcctgagttg ttgggtgcca taattaactg gctaggctac tccaactccc      1200
     tgctcaaccc agttatttat gcttatttca acaaagactt tcaaaacgct tttaagaaga      1260
     tcatcaagtg caagttctgc cgctgatgat gatgatggtg gtggtagtgg tggtaatagt      1320
     ggtggtgatg gagaaggaag aagtggagga agagtgtagg gcttacagga cccttcctgt      1380
     tcactcaata tccccgccct ggaagcaaca cctaagaaaa cttgcttttc ctagaacacg      1440
     cagcttctta gcccatggct ttcagatctt ctctctctat ctcattttaa ggggacagtg      1500
     ctttttgcag aaatcttaga gaacccctag catctgtttg taaaattatt ggctcggtct      1560
     ttggccctag gatcagtttt gatagttgca ataacctcct ctctattcga aatcccaatt      1620
     cttcacgatg gaagtttaaa cctcggcgat tcaaggaaga aaacccaaac agaaaatata      1680
     aactgtatgg acatctacca tgcccactag gactgccacc ctctgcccta tatctggaac      1740
     tttgaggttc aagactgctc tgtctctccc tccctcttgc tctagaaaca tctgttccct      1800
     ttgggtgtca atgtacactg ctgattctgg tctccatgca ctcacggctg gtctgggaaa      1860
     gttggaacta ctttgggtta tggtgccctg gaattgtttg ccttgctgaa tagcaaaaga      1920
     tccctttccc caatgcacag cacccacttt ctgtattttg tttgtttgtt tgttttaact      1980
     caaaatcaag tgacaaagat gtctgctgga gtggacttat aagcaagaag ccaggcccaa      2040
     aaggaagagc caagaaggcc tgcggatgtt ttcctgtcct ggtgtcagca ctcaccaaag      2100
     aaattgacaa tcagactatt tggaaggaag agttttattc ctgtagtttg ttggcttttc      2160
     tgtaagttct ggaaaggcct tgtggactgc agaaggcgcc cactgctggc cagggagggc      2220
     tcattgaggg tgctgagatg cccgggatgg ctcacctcac cctcagtttc ttttctagga      2280
     gtgagctatg ccagagcagc tcaccttgag tttgcagcct ccgggttcct ccactcacct      2340
     ctcacagtat ccaggagcta gtagagaagt ttgagtttgt gcaagaggtt ggagacttag      2400
     aatttctaag gaagtgtggg tgtgaggcac gtagaggagg taaggagcaa aagggctcct      2460
     aagtgcttcc aactcctgcg gcgtgcccag ggggtggggg tgacctaaag gggcaatttt      2520
     aagcatagga tgcaaagttt ctcaatctac cccttccccc tttcaaggaa cagcattgtg      2580
     tagcatttcc taaaaatgcc cggatttatt ctccgggaca ttctgtgctc acacaaattt      2640
     cgcagatctc tgggctctca ttgtgaaggg tatcaacacc tcaccattac ctacctagga      2700
     tcttgatctc agagacctaa aagagagagc gatctctgtg gagtcccagc caagtcagcc      2760
     cccaaattct gagggtaaaa ccagttttgt gtcctctcaa tttttaaagc atttttctcc      2820
     gctaggggtt cttttcctgc tgttattttt gctgtcccac ccccacctca gagaagaaaa      2880
     ttatttaggt gcttcctttg aatgtacatt tctagctaag tgagagggca tcaaatggtt      2940
     ttgcgttata tctgaacttc gaattttctg ttgaataatg gtttcctttt caagcaatta      3000
     tacggagatt tttttcaccc cccatcccct tcagctgtat ctttccaatg tctgcacctg      3060
     ctgttttgaa aacccgtgct gcattttttt ttaaattgcc aaagttgctg gtg             3113
//