spacer

EBI Dbfetch

ID   AK042767; SV 1; linear; mRNA; HTC; MUS; 3405 BP.
XX
AC   AK042767;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 7 days neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:A730022G11 product:platelet-derived growth factor, C
DE   polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3405
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f6f7639dc5404b78547d9d726ff5a0fd.
DR   Ensembl-Gn; ENSMUSG00000028019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029652; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A730022G11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3405
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="7 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A730022G11"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             769..1806
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="platelet-derived growth factor, C polypeptide
FT                   (MGD|MGI:1859631 GB|NM_019971, evidence: BLASTN, 99%,
FT                   match=2691)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CI19"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:1859631"
FT                   /protein_id="BAC31358.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDIC
FT                   KYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
XX
SQ   Sequence 3405 BP; 854 A; 830 C; 819 G; 902 T; 0 other;
     gagccgcccg tgcttagccg ccacctctcc tcagccctgc gtcctgccct gccttagggc        60
     aggcatccga gcgctcgcga ctccgagccg cccaagctct cccggcttcc cgcagcactt       120
     cgccggtacc cgagggaact tcggtggcca ccgactgcag caaggaggag gctccgcggt       180
     ggatccgggc cagtcccgag tcgtccccgc ggcctctctg cccgcccggg acccgcgcgg       240
     cactcgcagg gcacggtccc ctccccccag gtgggggtgg ggcgccgcct gccgccccga       300
     tcagcagctt tgtcattgat cccaaggtgc tcgcctcgct gccgacctgg cttccagtct       360
     ggcttggcgg gaccccgagt cctcgcctgt gtcctgtccc ccaaactgac aggtgctccc       420
     tgcgagtcgc cacgactcat cgccgctccc ccgcgtcccc accccttctt tcctccctcg       480
     cctaccccca ccccccgcac ttcggcacag ctcaggattt gtttaaacct tgggaaactg       540
     gttcaggtcc aggttttgct ttgatccttt tcaaaaactg gagacacaga agagggctct       600
     aggaaaaact tttggatggg attatgtgga aactaccctg cgattctctg ctgccagagc       660
     cggccaggcg cttccaccgc agcgcagcct ttccccggct gggctgagcc ttggagtcgt       720
     cgcttcccca gtgcccgccg cgagtgagcc ctcgccccag tcagccaaat gctcctcctc       780
     ggcctcctcc tgctgacatc tgccctggcc ggccaaagaa cggggactcg ggctgagtcc       840
     aacctgagca gcaagttgca gctctccagc gacaaggaac agaacggagt gcaagatccc       900
     cggcatgaga gagttgtcac tatatctggt aatgggagca tccacagccc gaagtttcct       960
     catacatacc caagaaatat ggtgctggtg tggagattag ttgcagtaga tgaaaatgtg      1020
     cggatccagc tgacatttga tgagagattt gggctggaag atccagaaga cgatatatgc      1080
     aagtatgatt ttgtagaagt tgaggagccc agtgatggaa gtgttttagg acgctggtgt      1140
     ggttctggga ctgtgccagg aaagcagact tctaaaggaa atcatatcag gataagattt      1200
     gtatctgatg agtattttcc atctgaaccc ggattctgca tccactacag tattatcatg      1260
     ccacaagtca cagaaaccac gagtccttcg gtgttgcccc cttcatcttt gtcattggac      1320
     ctgctcaaca atgctgtgac tgccttcagt accttggaag agctgattcg gtacctagag      1380
     ccagatcgat ggcaggtgga cttggacagc ctctacaagc caacatggca gcttttgggc      1440
     aaggctttcc tgtatgggaa aaaaagcaaa gtggtgaatc tgaatctcct caaggaagag      1500
     gtaaaactct acagctgcac accccggaac ttctcagtgt ccatacggga agagctaaag      1560
     aggacagata ccatattctg gccaggttgt ctcctggtca agcgctgtgg aggaaattgt      1620
     gcctgttgtc tccataattg caatgaatgt cagtgtgtcc cacgtaaagt tacaaaaaag      1680
     taccatgagg tccttcagtt gagaccaaaa actggagtca agggattgca taagtcactc      1740
     actgatgtgg ctctggaaca ccacgaggaa tgtgactgtg tgtgtagagg aaacgcagga      1800
     gggtaactgc agccttcgta gcagcacacg tgagcactgg cattctgtgt acccccacaa      1860
     gcaaccttca tccccaccag cgttggccgc agggctctca gctgctgatg ctggctatgg      1920
     taaagatctt actcgtctcc aaccaaattc tcagttgttt gcttcaatag ccttcccctg      1980
     caggacttca agtgtcttct aaaagaccag aggcaccaag aggagtcaat cacaaagcac      2040
     tgccttctag aggaagccca gacaatggtc ttctgaccac agaaacaaat gaaatgaatg      2100
     tagatcgcta gcaaactctg gagtgacagc atttcttttc cactgacaga atggtgtagc      2160
     ttagttgtct tgatatgggc aagtgatgtc agcacaagaa aatggtgaaa aacacacact      2220
     tgattgtgaa caatgcagaa atacttggat ttctccaacc tgtttgcata gatagacaga      2280
     tgctctgttt tctacaaact caaagctttt agagagcagc tatgttaata ggaattaaat      2340
     gtgccatgct gaaaggaaag actgaagttt tcaatgcttg gcaacttctc cgcaatttgg      2400
     aggaaaggtg cggtcatggt ttggagaaag cacacctgca cagaggagtg gccttccctt      2460
     cccttccctc tgaggtggct tctgtgtttc attgtgtata tttttatatt ctccttttga      2520
     cattataact gttggctttt ctaatcttgt taaatatttc tatttttacc aaaggtattt      2580
     aatattcttt tttatgacaa cctagagcaa ttatttttag cttgataatt tttttttcta      2640
     aacaaaattg ttatagccag aagaacaaag atgattgata taaagatctt gttgctctga      2700
     caaaaacata tgtatttctt ccttgtatgg tgctagagct tagcgtcatc tgcatttgaa      2760
     aagatggaat ggggaagttt ttagaattgg taggtcgcag ggacagtttg ataacaactg      2820
     tactatcatc aattcccaat tctgttctta gagctacgaa cagaacagag cttgagtaaa      2880
     tatggagcca ttgctaacct acccctttct atgggaaata ggagtatagc tcagagaagc      2940
     acgtccccag aaacctcgac catttctagg cacagtgttc tgggctatgc tgcgctgtat      3000
     ggacatatcc tatttatttc aatactaggg ttttattacc tttaaactct gctccataca      3060
     cttgtattaa tacatggata tttttatgta cagaagtata tcatttaagg agttcactta      3120
     ttatactctt tggcaattgc aaagaaaatc aacataatac attgcttgta aatgcttaat      3180
     ctgtgcccaa gttttgtggt gactatttga attaaaatgt attgaatcat caaataaaat      3240
     aatctggcta ttttggggac aagtgtaagt gttcgtctaa gtgtatgtgg tgtgtgtggg      3300
     ggggggtgag gcggttgtgg gtatccatga gtgtgaacat gtctgcctct ttggttccaa      3360
     ggaaaggaag ataataaagt actcagttac catcttttgc attgt                      3405
//


spacer
spacer