spacer

EBI Dbfetch

ID   AK042231; SV 1; linear; mRNA; HTC; MUS; 2362 BP.
XX
AC   AK042231;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus 3 days neonate thymus cDNA, RIKEN full-length enriched
DE   library, clone:A630073F06 product:hypothetical Trp-Asp (WD) repeats
DE   profile/Trp-Asp (WD) repeats circular profile/G-protein beta WD-40 repeats
DE   containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2362
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1b439e6f86c7bb4fb8acff4033a3f373.
DR   Ensembl-Gn; ENSMUSG00000027778; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169064; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A630073F06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2362
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="3 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A630073F06"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             110..>2362
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Trp-Asp (WD) repeats profile/Trp-Asp
FT                   (WD) repeats circular profile/G-protein beta WD-40 repeats
FT                   containing protein (PROSITE|PS50082 PROSITE|PS50294
FT                   InterPro|IPR001680, evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8K057"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1915509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K057"
FT                   /protein_id="BAC31200.1"
FT                   /translation="MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTS
FT                   ETSLIVKLPDDIYPIDLHWFPKSLGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEA
FT                   HCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVL
FT                   YTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVL
FT                   YGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDG
FT                   TQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKA
FT                   SLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSY
FT                   EGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLS
FT                   HKNEISEIALDQKGLTNDRKIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDT
FT                   CNILCGIQDTRFTVWYYPNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRA
FT                   DGSLVHISISPYPAILHEYVSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEI
FT                   AYAAVGEIDKVRYINAIKDLPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQININ
FT                   LYNWERALELAVKYKTHVDTVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKA"
XX
SQ   Sequence 2362 BP; 702 A; 491 C; 575 G; 594 T; 0 other;
     agaggctatt tggtaactag ttcgagctct gagagcagtc gccaccgctt tcctggaact        60
     tgagtgaata caatcaagcg gtatttaaca tttctctgga actggagaca tgagactgaa       120
     gatatctctc tcaaaggaac caaagcatca agaattagtg agctgtgtgg gttggactac       180
     ggcggaggag ctgtactcat gcagtgacga ccaccagatc gtcaagtgga acctgctaac       240
     cagtgaaacc agcctaatag tcaagctgcc tgatgacatc tacccgatag accttcactg       300
     gtttccaaag agtttaggca taaagaaaca gacgcaggca gaaagcttcg tcctcacaag       360
     ctctgatggt aagtttcatc tgatttccaa gttaggaaga gtggaaaaga gtgtagaagc       420
     tcactgtggg gctgtgctcg caggacgatg gaattatgag gggactgcat tagtgacagt       480
     tggagaagat ggacaagtga aaatctggtc aaagacaggg atgctcagat caactttagc       540
     ccagcaagga acaccagtgt actcagtagc ctggggccct gattcagaaa aggttcttta       600
     tacagcaggc aaacagctca tcattaaacc tcttcaacca aatgctaaag ttttacagtg       660
     gaaagcccat gatggcatca ttttaaaagt cgactggaac tcagtgaatg accttatttt       720
     atctgcgggt gaagactgta agtataaggt ttgggatagt tatggccgcg tgctgtacgg       780
     ctcccagcct catgagcacc ccatcacctc agtggcctgg gctccagatg gggagttatt       840
     tgccgttgga tcgtttcata cgttacgctt gtgtgataaa actgggtggt catatgcttt       900
     agagaaaccc aacactggca gcatatttaa cattgcgtgg tctattgatg gcactcagat       960
     cgcgggagcc tgtgggaacg ggcatgttgt ctttgcacat gtggtggagc agcgctggga      1020
     gtggaaaaat tttcaagtaa cgctaacgaa gagaaggacc atgcaggttc gcaacgttct      1080
     caatgatgcc gtggatctcc tggagttccg ggacagagtc attaaagcat ccttaaacca      1140
     cgcacacttg gtggtctcca cgtccctgca gtgctacgtg ttctctacga agaactggaa      1200
     tacaccactt atatttgatc tcaaagaagg aactgttagt ttaattctgc aggcagaaag      1260
     acattttctt ctggtggatg gcgggggtat ctacctgcac tcttatgaag ggcgcttcat      1320
     ttcttctcca aagtttcctg gcatgagaac agacatcctg aacgctcaga ctgtgtctct      1380
     gagcaatgac acgatagcaa taaaggacaa agctgacgag aagataatct tcctctttga      1440
     ggcgtcaact ggaaaacccc taggggatgg gaaacttctt tctcataaga atgaaatctc      1500
     agaaattgct ctggatcaaa aaggacttac caatgacaga aaaattgctt tcattgacaa      1560
     gaacagagat ctctacatca cctctgtgaa acgatttggg aaagaagaac agattattaa      1620
     acttggaacc atggtacata ctttggcatg gtgtgataca tgcaatatcc tctgtggaat      1680
     tcaagatact cgattcacag tatggtatta ccctaatacc atttatgtgg acagagacat      1740
     tctgcctaaa acattgtacg aaagagatgc aagtgaatat agtaaaaacc cgcatatagt      1800
     gagttttgtt ggaaatcagg taactataag aagagctgat ggctccctgg tgcacatcag      1860
     catatcaccg taccccgcca tcctccatga gtatgtgagc agctccaagt gggaagaggc      1920
     tgtaaggctt tgccgctttg ttaaggagca aagcatgtgg gcttgcctag cggctatggc      1980
     tgttgctaat cgagatatgg tcactgcaga aatagcctat gcagcagttg gggaaattga      2040
     taaagttcgg tacatcaatg ctataaaaga tcttccatct agagagtcaa aaatggccca      2100
     catactcatg tttagtggga acatccagga ggctgaaaca gtcctgctcc aggctggcct      2160
     tgtttatcaa gccatacaga tcaacattaa tctctataac tgggaaaggg cgctggagtt      2220
     ggctgtaaaa tacaaaaccc acgttgatac agtgctcgct tatcgtcaga agttcttgga      2280
     cacatttggt aaacaggaaa ctaataaacg atatttacaa tatgcagagg gcctccaaat      2340
     agactgggag aaaatcaaag cc                                               2362
//


spacer
spacer