spacer

EBI Dbfetch

ID   AK041300; SV 1; linear; mRNA; HTC; MUS; 2299 BP.
XX
AC   AK041300;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male aorta and vein cDNA, RIKEN full-length enriched
DE   library, clone:A530098A22 product:transient receptor protein 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2299
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8ffe54f3130b871ebb7698bd78cedc28.
DR   Ensembl-Gn; ENSMUSG00000070425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123372; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A530098A22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2299
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A530098A22"
FT                   /tissue_type="aorta and vein"
FT                   /db_xref="taxon:10090"
FT   CDS             550..1491
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="transient receptor protein 2 (MGD|MGI:109527
FT                   GB|NM_011644, evidence: BLASTN, 100%, match=822)"
FT                   /db_xref="GOA:Q8BRU2"
FT                   /db_xref="InterPro:IPR002706"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:5546358"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BRU2"
FT                   /protein_id="BAC30894.1"
FT                   /translation="MLMSRTDSKSGKNRSGVRMFKDGDFLTPASGESWDRLRLTCSQPF
FT                   TRHQSFGLAFLRVRSSLGSLADPVVDPSAPGSSGLNQNSTDVLESDPRPWLTNPSIRRT
FT                   FFPDPQTSTKEISELKGMLKQLQPGPLGRAARMVLSAARKAPPASVVSPNNSHGEPGPS
FT                   RAESAEPRAEEPNRKTAVGRRKRRKVQEPRRSLSNSSSQPNRRTGRTRQRQHRPQTKSD
FT                   DGGVQAAGQCPICAGFFSIETLPQHAATCGESPPPQPASPASLSSSESVLWVSSPESSP
FT                   PPSWVQCPICELQFSAREIEEHASVCGEVLPA"
XX
SQ   Sequence 2299 BP; 547 A; 588 C; 606 G; 558 T; 0 other;
     gggagctccg gagctgaggc taccacgacg taaagtttac gaactcggcc tacccaaagc        60
     tgggatcata gtcctagggc accacatcca cctcggagga atgaaagcta tttcaggaag       120
     attccttgaa cagacaaagc aaggagtaat ataaagattc ttgttctccc aaaagctacc       180
     aagagcaaaa catcaacagt accaccgtgg ctacagaaga catcggggga ggaagcgtgt       240
     cttcctcgca cttaaggaag ctggtggcgt ccgatggctc ctgtgaagat cagccatgtg       300
     gtgtcatttt cctctcagga tcccaaatat cctgtggaga acttgctgaa cccagacagt       360
     cacaggggac cctggctcag ctgccctcag gacaagactg gacaactgaa agtggagttt       420
     cagctggaga gggcagtgcc cataagctat attgatgttg gaaactgtgg ctgtgctttc       480
     ctacagattg atgtgggtcg ttcttcctgg cccctggaca gacctttcgt caccctgctc       540
     cctgccacca tgctaatgtc ccgcactgac tccaagtcgg ggaagaaccg ctcaggggtc       600
     cggatgttta aagatggtga tttcctgact ccagcctcag gagagtcctg ggatcgactt       660
     cgattgacct gctcccaacc tttcacacgt catcagtcct ttggcctggc cttcctacga       720
     gtgcgttcct ctctgggctc tctggctgac cctgtagtag atccctcagc ccctgggagc       780
     tctgggctta accagaactc tacagatgtg ctggagtctg atcctaggcc ctggctgact       840
     aatccttcta tccggaggac attcttcccc gatccccaga cgagcaccaa ggaaatttca       900
     gagctcaagg gtatgttgaa gcagttgcag ccagggcctc tggggcgggc agcccgcatg       960
     gtgctttctg ctgcccgtaa ggcccctcca gccagtgtgg taagcccaaa caacagccac      1020
     ggagaaccag gtcccagccg tgcagagagt gcagagccca gagcagaaga accaaacagg      1080
     aagacggctg tgggcagaag gaagaggagg aaagtgcagg agccaaggag atcgttgtcc      1140
     aactcgagtt ctcagccaaa taggaggaca ggaaggacaa gacaaagaca gcaccgacct      1200
     cagaccaaaa gtgatgacgg tggtgtgcag gctgctggac agtgtcctat ttgtgcaggt      1260
     ttcttcagta ttgagactct tccccagcat gctgcaactt gtggagagag ccccccaccc      1320
     cagccagctt ctcctgcctc cttgtcttcc tcggagtccg tgctgtgggt ctcctcccca      1380
     gagagctcgc cgccaccttc ctgggtccag tgccctatct gtgaattaca gttctcagca      1440
     agagaaatag aagaacatgc cagcgtgtgt ggggaagttt tgccagcctg agcagtgacg      1500
     ttctgttgac cctttatgtt ggagcctggg gaatggatct ctggtggcta agaagggttg      1560
     ggtcccctcc ctccagctat tactcaggac tccgcctgcc tgagaacact gtggacccag      1620
     cttgctcccc attcctgttg tcaaggcttt gtcactatgg tacccaattc tcaaaggata      1680
     ttttcccctt agaacttctt tggtagaatt gatgatctct ccaaggcctt aggatactat      1740
     ctagaatgtg ttacctaatg cccattttcc tgaatgaaaa actgaggctc agtcaggggg      1800
     aaataatggc tgggaattat aaagttatgc tgtttgggaa gatgagtgaa tgagtcttga      1860
     gtgtgaaact aacgagttcc atatgacctt gaccttctgt gttcttcatg ggtatctgtc      1920
     tcagatgtag tcagatgact ctgaaacttt acttctcatg ggtgtgaaat ggatcttcag      1980
     taacatgaaa accctcttcc tactcacatg gttcttaagg gagccagaga gattcctttc      2040
     taaggagtag atgattctgg gcatggcttg taagggtttg agcaaatctc attccaacta      2100
     tttgagatag ttggaccaca gtgtctcccc tggagctgtg gtagttcaat tctgctttaa      2160
     agaattgtgc acgcttccct ttttccccag gagacgtaat catgtggcac taacacccgt      2220
     tccccttgtc cccaaggtac gaggcaggga gagagcagct ggtcctgatg aagggagggc      2280
     acagggtggg gctttgggt                                                   2299
//


spacer
spacer