spacer

EBI Dbfetch

ID   AK040878; SV 1; linear; mRNA; HTC; MUS; 4455 BP.
XX
AC   AK040878;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male aorta and vein cDNA, RIKEN full-length enriched
DE   library, clone:A530032M21 product:chemokine (C motif) XC receptor 1, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4455
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bb2009c73d1863f6373c9a42b1eb8726.
DR   Ensembl-Gn; ENSMUSG00000060509; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182350; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A530032M21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4455
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A530032M21"
FT                   /tissue_type="aorta and vein"
FT                   /db_xref="taxon:10090"
FT   CDS             122..1090
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="chemokine (C motif) XC receptor 1 (MGD|MGI:1346338
FT                   GB|NM_011798, evidence: BLASTN, 100%, match=969)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q544D8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR005393"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1346338"
FT                   /db_xref="UniProtKB/TrEMBL:Q544D8"
FT                   /protein_id="BAC30730.1"
FT                   /translation="MESSTAFYDYHDKLSLLCENNVIFFSTISTIVLYSLVFLLSLVGN
FT                   SLVLWVLVKYENLESLTNIFILNLCLSDLMFSCLLPVLISAQWSWFLGDFFCKFFNMIF
FT                   GISLYSSIFFLTIMTIHRYLSVVSPISTLGIHTLRCRVLVTSCVWAASILFSIPDAVFH
FT                   KVISLNCKYSEHHGFLASVYQHNIFFLLSMGIILFCYVQILRTLFRTRSRQRHRTVRLI
FT                   FTVVVAYFLSWAPYNLTLFLKTGIIQQSCESLQQLDIAMIICRHLAFSHCCFNPVLYVF
FT                   VGIKFRRHLKHLFQQVWLCRKTSSTVPCSPGTFTYEGPSFY"
FT   regulatory      4440..4445
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4455
FT                   /note="putative"
XX
SQ   Sequence 4455 BP; 1253 A; 1034 C; 837 G; 1331 T; 0 other;
     ggttacctac gtgaaactct agcactggag gagatcaaag gaagcacaaa gcgtacagac        60
     ttgaaaccct gacatggact cagagtcaga tgctctcagt atccctgcat cccgcgtcca       120
     gatggagtcc tctacagcct tttatgatta tcatgataaa ttgagtcttc tatgtgagaa       180
     caatgtcatc ttcttttcca ccatctctac cattgtcctg tactctctgg tatttctcct       240
     cagccttgtg ggtaacagcc tggttttgtg ggtcttggtg aagtatgaga atctagagtc       300
     actcaccaat atcttcatcc tcaacctgtg tctctcagac ctgatgttct cctgtctact       360
     gcctgtgttg atctcagcac aatggagttg gtttctaggt gacttcttct gcaagttctt       420
     caacatgatc ttcggcatca gcctctacag cagcatcttc ttccttacca tcatgaccat       480
     ccaccgatac ctgtctgtag tgagccccat ctctactctg ggtatccata ccctccgctg       540
     ccgtgtgctg gtgacatcat gtgtgtgggc agccagcatc ctgttctcca tccctgatgc       600
     tgtcttccac aaagtgatct ccttaaattg taaatattct gaacatcatg ggttcttggc       660
     ctcagtctac cagcacaaca tcttcttcct cctctccatg ggaatcatcc tattctgtta       720
     tgtacagatt ctcaggactt tgtttcgcac aaggtccaga cagagacacc gaacagtcag       780
     gctcatcttc accgtcgtgg tagcatactt cctcagctgg gctccctaca acctcacact       840
     cttcctgaaa actggaatca tccagcagag ctgtgagagc cttcagcaac tggacattgc       900
     tatgattatc tgtcgccatt tggccttctc tcattgctgt ttcaacccag tgctttatgt       960
     ctttgttggg atcaagttcc gcagacacct aaaacatctc ttccagcagg tctggctgtg      1020
     ccggaagaca tccagcactg ttccctgctc ccctggtacc tttacatatg agggaccctc      1080
     cttctactga gaggagagga tgggcacatg gagatgacta tgggaggtaa aggaagacaa      1140
     ggagaagtgg atcaggaagg aaaatataac tgaagatact acagagtgtg gaggaaagac      1200
     atgataccca tggggaagtg gcttccagct gggcaagcca aagcaacact tcgtgcactc      1260
     agttcatcat ttattctctt acttagacat agattgcttg ttagtgatgg tcagaagatc      1320
     ctaaatagaa ggatttctag actttaggag ggcttgaagc ttatagtatg tgctaactgt      1380
     gcagtgatgt tgctggtaca tagggttgcc ccaaactatt tttttttcac cttggtgata      1440
     gctgactctg tgattcttag cagctacaga aagaaaaaaa actctcttca ggacaagaat      1500
     aatcacatct ttaaataagt acagtcacaa tgaagtctat accataaaat cccactaaaa      1560
     tgaagatggt tctgagccgg gtgtggtggc gcatgccttt aatcccagca ctcaggaggc      1620
     agagacaggc agatttctga gtttgaggcc agcctggtct acagagtgag ttccaggaca      1680
     gccagggcta cacagagaaa ccctgtcttg aaaaacaaaa caaaacaaaa caaaacaaaa      1740
     caaaaaaaca acaacaacaa agatggttcc atattctggc aacagctgct aacacataag      1800
     ctggctttta aatatttagc tcataactga aagaaaaaat acaatatgtg ctactgtctg      1860
     cactaagtaa ttatttggac aatacaaaga tgaataggat attgctgcta actttcagtt      1920
     gacaccaatc catccaagaa ggtccagata agaaaagtcc acttaacaga ggcattcagg      1980
     ttgaatattc ctgtcatttc atctcttcca gattgagaga aagatgactt ccttacatgt      2040
     ggataataat gccagcattc ccctcttaac cattctccag agctaaattc tcctcatgca      2100
     ccacattccc tttcgcagag ccaggtcccg tggattctgc cttcccaaca tctctccagc      2160
     ttatgagcac atacccttga cttcatcttt atagtgccct ctgttccata gtatcttcct      2220
     tttgcttcta tttttcctct gttacatctt cctccttcag gaagctgcct gcctgagatt      2280
     tatcttttat tttacagctc ctctgcctag agtctgtctt tgacgcttta ataaaattgt      2340
     cctcaagctc ccttctgagt tacttcttaa attcttttat taataaaact agtaacacaa      2400
     aagagggccc agatttccct ggtaatataa ggttactcca tcagaatgct ccagaatttc      2460
     aggtaacatt attacctttg gggcagttta gactgttata tctgcatcca gggccaaaga      2520
     cagaactcag atcctgttct ttcaaccaaa aataaataca taaaaacata taacagtaga      2580
     ctttaaagaa ttaatgaaaa aattaaaaga cataaaatag ttatggatta cccagaagaa      2640
     gtaactttca agtggataga gggatggctc agcagttaag agcactggct actcctccag      2700
     agggcctaaa ttcagttccc aaagcccaca tggtatctcc caaccatttt aactgcagtt      2760
     ccaagggaat ccattgccct cttctggcct cctttccttt gtacacgaag atgaacattt      2820
     catatatctt acaatgtgtc ggttagagat ccctcgggca ccttacactt catcctagtt      2880
     tatatctctg cccattagcc aggtgggctt gaaattcctt ttcttctaaa agcctcaatt      2940
     tcatctttga agttcagaaa tgaaccctac ctatagcaca gagctgtgtt gagttttaaa      3000
     cataacatta tataggcttt tggttagggt atgacatatt aggtttttaa tatatacaat      3060
     aatctactgc acaatatttt ggtcaatgtt ggaccacata tcactgtgct cccttaagac      3120
     taaatcatct agtgatgtca tagtcatctt aatttatcta actatactcc agatgaattg      3180
     tctatgaaat tctcaaaata catcattgcc cttaaataac ccatgattgc ttgagacctg      3240
     tcttcctctt ctctgtaaat ttatttggga tctaagtttc aaacaagggt gtttgaaatc      3300
     ccttttgtgg gaacaggact gaggatgggc atttagaggc gacagagtca cgtgacaact      3360
     cctggtaaat aaagctccag agatcagtat cagtgtgcag atctgcattt attgccaagc      3420
     acataagctt atatacagta tttgagccaa tcccaagccc ctaaatcctt ggccaagcat      3480
     aacttactac atctcaccat atcccaataa aagctgtgac tgatgaggta actcagagag      3540
     aaggggtgtg gcgagcattg tcacctgtag ggacttttgt gaagactcag aagcagccac      3600
     tgtcttgacc ttagttcctt tttgctgtct cactggtgtc ccgggagcca tcttagatct      3660
     gacaccatgt acagcagatc aggactctgt ggcacagtgc tctccacccc acatattcct      3720
     tcacaaggtt gtcttccaca tgcctcacac tctcaatctt aacatcccaa agctgttcag      3780
     gctgtagtca gagcaagttt ttcttagttc actctattga taaatcttta tttctgatgt      3840
     catttcctcc cacttcttcc cttttttttg ttttcctttg ttaacagaaa ggggaatcat      3900
     ttctcttcgt gaggtttttt ttatcctcat ccacaaactg acaactccat caagttaata      3960
     tgttgtctca tatacctcca gtataaaata tgaaattaac ttaaaagatt tcttttcctt      4020
     cctgtatgaa tttatcctga gaacctggaa tgctgaagtc tggcagatgc cactattagc      4080
     taagtcctgt aaggtacaca agcatttcta gctaacatga tgaaaataag gcagtgtgag      4140
     gagccagcca gagctaagaa gcgaacctaa tcatgggctg acattcctat gtactgtccc      4200
     ctgtctttag catgttcatc catactggac ttggaatgca gtgttctatt gcaccaggct      4260
     tcagggtgct ttgcaactca gcaacaagca aacacgggac tgaggaagct aagcatggta      4320
     gttctttagc acatattttc aaacactgtt tttttaagtg tctgttaatg agggggaaac      4380
     aaaaactgag aacttaggtc cagcagtaca tactaagttc attttttttt agcttcataa      4440
     ataaaacgta atagt                                                       4455
//


spacer
spacer