Dbfetch

ID   AK040350; SV 1; linear; mRNA; HTC; MUS; 3178 BP.
XX
AC   AK040350;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate thymus cDNA, RIKEN full-length enriched library,
DE   clone:A430088E13 product:type 1 tumor necrosis factor receptor shedding
DE   aminopeptidase regulator, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3178
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bd62dd27abc9cc4daa655ab734703931.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A430088E13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3178
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A430088E13"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2086
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="type 1 tumor necrosis factor receptor shedding
FT                   aminopeptidase regulator (MGD|MGI:1933403 GB|NM_030711,
FT                   evidence: BLASTN, 100%, match=2176)"
FT                   /db_xref="GOA:Q8C9W5"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR033520"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="MGI:MGI:1933403"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9W5"
FT                   /protein_id="BAC30569.1"
FT                   /translation="AFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEF
FT                   YEDYFNIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIV
FT                   SHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEV
FT                   DALNSSHPVSTPVENPAQIREMFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYS
FT                   YKNTKNEDLWNSMMHICPTDGTQTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQK
FT                   GFPLITITVSGRNVHMKQEHYMKGSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTD
FT                   VLILPEAVQWIKFNVGMNGYYIVHYADDGWASLSGLLKEAHTTISSNDRASLINNAFQL
FT                   VSIEKLSIEKALDLTLYLKNETEIMPIFQALNELIPMYKLMEKRDMIEVETQFKDFLLK
FT                   LLKDLIDKQTWTDEGSVSERMLRSQLLLLACVRNYQPCVQRAERYFREWKSSNGNMSIP
FT                   IDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFK
FT                   GEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQF
FT                   STRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
FT                   "
FT   regulatory      3157..3162
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3178
FT                   /note="putative"
XX
SQ   Sequence 3178 BP; 936 A; 619 C; 684 G; 939 T; 0 other;
     ggccttcatc atttctgatt ttaagtctgt gagcaagatg actaagagtg gagtcaaggt        60
     ttctgtgtat gctgtgccag acaagataaa tcaagccgat tatgctctgg atgctgcagt       120
     gactcttcta gagttttatg aggattattt caacattcca tatcctttac ccaagcaaga       180
     tcttgctgca atcccagact ttcagtctgg tgctatggaa aactggggac tgaccacata       240
     cagagagtcc tctctgttat acgataaaga aaagtcttct gcatctagta agcttggcat       300
     cacaatgatt gtgtcccatg aactggctca ccagtggttc gggaacctgg tcaccatgga       360
     atggtggaat gacctttggc tcaatgaagg atttgccaaa tttatggagt ttgtgtctgt       420
     cactgtgacc catcctgaac taaaagttga agactatttc tttggcaagt gttttaatgc       480
     aatggaagtt gatgcattaa actcctctca ccctgtatcc acacctgtgg agaatcctgc       540
     gcagattcgg gagatgtttg atgatgtttc ttatgaaaag ggagcttgta ttctgaatat       600
     gctaagagat tatctgagtg cagatacatt taaaagagga attgtacagt atctccaaaa       660
     gtatagttat aaaaacacaa aaaacgagga cctgtggaat agcatgatgc atatttgccc       720
     tacagatggc acacaaacaa tggatggctt ctgctctaga agccaacact catcatcaac       780
     ctcacactgg cgtcaggagg ttgtagatgt aaagaccatg atgaacacat ggacactgca       840
     gaagggcttt cctctgataa ccatcactgt gagtgggcgg aatgtgcaca tgaagcaaga       900
     acactacatg aagggttcag aacgcttccc agagactggg tatttgtggc atgttccact       960
     gacattcatt accagcaaat cagactcagt ccagagattt ttgctgaaga caaagacaga      1020
     tgtgctcatc ctcccagaag cagtgcagtg gatcaaattt aacgtgggaa tgaatggcta      1080
     ttacattgtg cattacgcgg atgatggatg ggcttctctg agtggccttt taaaagaagc      1140
     gcacacaaca atcagcagta atgatcgggc aagtctcatc aacaatgcat ttcagctggt      1200
     cagcattgaa aagttatcaa tagaaaaagc cctggattta accctgtact tgaaaaatga      1260
     aactgaaatt atgcccatat tccaagcttt gaatgaactc atacctatgt ataagttaat      1320
     ggagaaaaga gatatgattg aggtggaaac tcaatttaag gacttccttc tcaagttgct      1380
     gaaggacctt attgataagc agacttggac agatgaaggc tctgtctcag agaggatgct      1440
     caggagccag ctcctcctcc tcgcatgtgt gcgcaattat cagccctgtg tgcagagggc      1500
     agagcgctat ttcagagagt ggaagtcatc taatggaaac atgagcatcc ctattgatgt      1560
     gaccttggct gtgtttgctg tcggggccca aaacacagaa ggctgggatt ttctttatag      1620
     taaatatcag tcttctttgt ctagtactga gaaaagccaa attgaatttt ccctctgtac      1680
     aagcaaagat ccagaaaaac ttcagtggct tctagatcaa agttttaagg gagagataat      1740
     aaaaactcag gaatttccac atattctcac actcattggc agaaacccag tgggttatcc      1800
     attggcctgg aagtttctga gggaaaattg gaataagctt gtacagaaat ttgaacttgg      1860
     ctcatcgtcc atagctcaca tggtaatggg aacaacagac cagttttcca ccagagcacg      1920
     tcttgaagag gtaaaaggat tcttcagttc cttgaaagaa aacggttctc agctccgttg      1980
     tgttcaacaa accattgaga ccattgaaga aaacatacga tggatggata agaattttga      2040
     taaaataaga ctgtggctgc aaaaagaaaa gccagagttg ctgtgacaat atgtttcttg      2100
     ccaagttcca gaatttatga tgagcaaaat tttgttcaat ttgagtattt ttaaactaaa      2160
     gatagttgtt ttggctacta ctgaagatat tttcttattt catttcactt gattatgtct      2220
     gagaaaagct tcaatgactg tgattgacag gtttaaaccc aagtgcccag ctccttgcca      2280
     cagaaaaacc cagggggctt cttctcagtt tatacttcag cttctgtgtc ggccattcat      2340
     cagtattttt gtaagactga atagtgaggc ataactgtgc agtgaatgct tggctcctta      2400
     gccatgctgg gaagtggctg tgcagcagcc ctcctgttga cctctctggc tctacagtcc      2460
     tgcagtctct cttcctgggt tcacttatgg gtgctgcctt gcaggatcca cttaatcaga      2520
     cacttttgcc ctctggattt tgttaatagt gtttggtagt tgttatccat gagggattgc      2580
     atagaggtgt ttattttctt gtacttgcct ctggctggct ttcaaccacc gtaagtctta      2640
     ctcctaagag gtggcctttc cccccccccc ccccccgcac tctgataact acttcctttt      2700
     catcctttgg ggcatggggc aacagtggaa acctgctgat accagtcatg gtagtacttg      2760
     tcattttcac tgaacctacg tgcacatttg tttttaaaaa tattgtatat ctataaccct      2820
     cgttggataa gtcaaatatg agagccactt actttctttg gaaggttatt tttaaaaatg      2880
     cagagtgcat tcagatctgt atcagaaata tctcgtttta agatatactt gtgagtcact      2940
     gatcccttaa gtagggagta gggttgtaaa ttcctaaata actcataata gcacttactg      3000
     aaaataaatc attgaggact cactaacaaa ggacaatatt aataatatgt ttatattagt      3060
     ataaggaaag attctttaaa tcttaaaaag atttttttga tgtatggcat aaatgatagg      3120
     aaaaatatca acatatggtg ctgtaatata ctatgaaata aagcgatttt aggggttc        3178
//