spacer

EBI Dbfetch

ID   AK040136; SV 1; linear; mRNA; HTC; MUS; 1762 BP.
XX
AC   AK040136;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 0 day neonate thymus cDNA, RIKEN full-length enriched library,
DE   clone:A430069C18 product:glutathione reductase 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1762
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fdbb8263e91f27b533359ada566c2946.
DR   Ensembl-Gn; ENSMUSG00000031584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033992; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A430069C18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1762
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A430069C18"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             12..1514
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutathione reductase 1 (MGD|MGI:95804 GB|NM_010344,
FT                   evidence: BLASTN, 98%, match=1640)"
FT                   /note="putative"
FT                   /db_xref="GOA:P47791"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:95804"
FT                   /protein_id="BAC30518.1"
FT                   /translation="MALLPRALGVGAAPSLRRAARALTCAMASPGEPQPPAPDTSSFDY
FT                   LVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDH
FT                   VDYGFQSCEGKFSWHVIKQKRDAYVSRLNTIYQNNLTKSHIEIIHGYATFADGPRPTVE
FT                   VNGKKFTAPHILIATGGVPTVPHESQIPGASLGITSDGFFQLEDLPSRSVIVGAGYIAV
FT                   EIAGILSALGSKTSLMIRHDKVLRNFDSLISSNCTEELENAGVEVLKFTQVKEVKKTSS
FT                   GLELQVVTSVPGRKPTTTMIPDVDCLLWAIGRDPNSKGLNLNKVGIQTDEKGHILVDEF
FT                   QNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPI
FT                   GTVGLTEDEAVHKYGKDNVKIYSTAFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQ
FT                   GIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR"
XX
SQ   Sequence 1762 BP; 421 A; 446 C; 498 G; 397 T; 0 other;
     gacttccgcg catggcgctg ctgccccggg cgctgggcgt gggcgcggcc ccgagcctgc        60
     ggcgggcagc gcgcgcgctc acctgcgcca tggcgagtcc cggcgagccg cagcccccgg       120
     ccccggacac ctcttccttc gactacctgg tgatcggcgg cggctccggc gggctggcca       180
     gcgcgcggcg ggcggcggag ctcggcgcca gggccgcggt ggtggagagt cacaagctgg       240
     gtggcacttg cgtgaatgtt ggatgtgtac ccaaaaaggt aatgtggaac acagcagtgc       300
     actcggaatt catgcacgat cacgtggatt acggctttca aagctgtgag ggtaaattca       360
     gttggcatgt catcaagcag aaaagggatg cctatgtgag ccgcctgaac accatctatc       420
     aaaataattt aaccaagtct cacatagaaa ttatccacgg ctatgcaaca ttcgcagatg       480
     gtcctcggcc cacggtggaa gtcaatggga aaaagtttac cgctccacac atcctgattg       540
     ccacaggagg cgtgcccaca gttcctcacg agagccagat cccaggcgcc agcctgggga       600
     tcaccagtga tggcttcttt cagctggagg acttgcccag ccgcagcgtc atcgtggggg       660
     ccgggtacat tgctgtggag atcgcgggca tcctctctgc cctgggctcc aagacatctc       720
     ttatgatcag gcatgataag gtactgagaa attttgattc actcatcagt tccaactgca       780
     ccgaggaact ggagaatgcc ggcgtggagg tgttgaagtt cacacaggtt aaggaagtaa       840
     aaaagacatc atcaggcctg gagctccaag tggtgacttc cgtgcctggt aggaagccca       900
     ccacgaccat gattccagat gttgactgcc tgctctgggc cattggacgg gacccaaatt       960
     ctaagggcct gaatctgaat aaagtgggca ttcagacgga tgaaaagggc cacatcctag      1020
     tagacgaatt ccagaatacc aatgtcaaag gcgtctatgc tgtgggagac gtctgtggga      1080
     aagcgcttct caccccagtt gcaatcgctg ctggccggaa acttgcccat agactgtttg      1140
     aatgcaaaca agattccaaa ttagactatg acaacatccc tactgtggtc ttcagccacc      1200
     cccctattgg gaccgtgggg ctcactgaag acgaagctgt tcataagtat gggaaagaca      1260
     atgtgaaaat ctactcgact gcctttaccc cgatgtatca cgctgtgacc acgaggaaga      1320
     cgaaatgcgt catgaagatg gtttgtgcca acaaagagga aaaggtggtt ggcattcaca      1380
     tgcaggggat tggctgtgat gagatgctgc agggcttcgc tgtagcggtg aaaatggggg      1440
     ccaccaaggc cgacttcgac aacacagttg ccattcatcc tacctcttca gaggagctgg      1500
     tcaccctgcg ctgagagcct ggggacccag gtggctagcg gtgcgaccag caggcctccg      1560
     ggaggaaccg atcgagttta cgcccagctt ctacagatct ctgtatttta atcaggaatt      1620
     tctggtggtg taaatttcca gctatacaca cgcacagaag aacttatgta tctaatcaga      1680
     aggttgtttt gttaatccgg ggttggtttt catttgataa tatttataat taatattttg      1740
     atttttttgt tgttgtttaa tt                                               1762
//


spacer
spacer