spacer

EBI Dbfetch

ID   AK039667; SV 1; linear; mRNA; HTC; MUS; 2434 BP.
XX
AC   AK039667;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male spinal cord cDNA, RIKEN full-length enriched
DE   library, clone:A330081F11 product:hypothetical Uncharacterised protein
DE   family Hly-III/UPF0073 containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2434
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; dbfd5ccb317999dfa37754ba9ce111e7.
DR   Ensembl-Gn; ENSMUSG00000030168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169744; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A330081F11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2434
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A330081F11"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             361..1212
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Uncharacterised protein family
FT                   Hly-III/UPF0073 containing protein (InterPro|IPR004254,
FT                   evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BQS5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:93830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BQS5"
FT                   /protein_id="BAC30412.1"
FT                   /translation="MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPS
FT                   LETPVCSSYYENSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWR
FT                   VIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLG
FT                   IFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSG
FT                   IALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGE
FT                   CM"
XX
SQ   Sequence 2434 BP; 586 A; 547 C; 573 G; 728 T; 0 other;
     gattggggct acaagtaaca aacacttgag aggcaggtgc tacgtgaacg gcctaggacg        60
     gctagggcgt cttttagccc agtgttttca gcacgccctc gtcccctggc tcaataggcc       120
     acgcccactg ttgggagtgt ccttctcttt cctagccgac ttcgttatta ctttcccaca       180
     tgtgcctggt gcaagtcttt ccacacaaca caagaatccg tggagctcag cagtaccctc       240
     agactctggt ctacaactct gacaggattt ggggtcaact taccatccct taaaaatcca       300
     ttctcccaag aagaagggac agaaagaaag accactttgt aagaaaggct ttggtatccc       360
     atgaacgagc cagccaaaca ccgattgggg tgcaccagga ctccagagcc agatatacgg       420
     ctcagaaaag ggcaccaact tgatgataca aggggaagta ataatgacaa ctaccaagga       480
     gatttggagc ccagcttaga gacacctgtt tgttcttcct attatgaaaa tagcccggag       540
     gagcccgagt gtcatgatga caattcccag gaagatgaag ggtttatggg catgtccccg       600
     ctcctacagg cccatcatgc tatggaacga atggaagagt ttgtttgtaa ggtgtgggaa       660
     ggccgatggc gagtgatccc tcacgatgtg ctaccggatt ggcttaagga taatgacttc       720
     cttctccatg gacaccggcc tcctatgcct tcctttcggg cctgttttaa gagcattttt       780
     agaatacaca cagagacggg caacatttgg acacatctcc taggttgtgt attcttcctg       840
     tgcctgggga tcttttatat gtttcgccca aatatatctt ttgtggcccc tctgcaagag       900
     aaagtggtct ttggcttgtt cttcttggga gccattctct gcctttcctt ttcatggctc       960
     ttccacacgg tgtactgcca ctcagaaggg gtctcccgac tcttctctaa attggattac      1020
     tctggtattg ctcttctgat catgggaagt tttgttcctt ggctttatta ttctttctac      1080
     tgtaacccac aaccttgctt catctacctg attgtcatct gtgtgctggg cattgcagcc      1140
     attatcgtct ctcagtggga catgtttgcc acccctcagt atcggggggt cagagcaggt      1200
     gagtgcatgt gagtgtgcag ttatcaccgg tcattcaagg tgcaccatta gaatcagagg      1260
     ctgtgctttt cagtgcagag acacagtaac tgtcctgctt gtccttaggc ttctgacctg      1320
     gtgctcagtt aggaggaagc acagggttga agggcagcga taagatgggt gcgcacctat      1380
     attttgagca gtgttgttta tttgaggaaa tatcacaata taatgacttc tgtattcttt      1440
     cagattagtg tacttgtgac tgattcttct tgtgttatac ttagtatttt atattttaat      1500
     ttaaattgct ttgataaata aggccagagt tcatgctgat tatgctccaa aaacctttga      1560
     tatttaggta gtgcctactg ggtgccctgt gacgttggca gccttcttgt tcaattgtgg      1620
     catttgcaca accagaagtt tgaaaaatac tgcctataat tttgaaagca gtagccttct      1680
     gctgagcgat actgacaaat cctaatgaac tgtgtctgaa gttgtgtctt ctgctttctg      1740
     tccctaaaat aacacgcagt acctcccaag tggtattaca acacatgttt cttcttgcta      1800
     taaaattcaa gccctggttc atctgtatgc acttcgaatg ctagaagaga actgacctct      1860
     tgttcctgac ctcccagcgt tctcgctcgc ctcccttttc agatgtcaca ggagcagatg      1920
     ggcaacagtc aaccctggct tttcagttcc tcactagggc agtggtgtta accgagttgg      1980
     agtacatggg ctaagaacat gtttgctgag tggagctgag cattaaacac taggctaagt      2040
     ctcagcctct gactggagag tgaaaagcac ttttagcaag gaaaagaaca gtgtagccat      2100
     gcttggagga cagaaggggg gtggaatcgt ttttatttgg gtctgcttgg tccccgactt      2160
     tgatgtagtt agcaagccat ttcttcctct catttaagtg catgcgtttc tgagtgtgag      2220
     tccatatgca tccatgtata tatgctgtgg catgctgtca gcttactggc aattctggag      2280
     gtcctggagt ctgtgaagag agcttaccaa atggcagcct cttgttgtat tctgcctgta      2340
     aaaggtagca ttgaagggag tttaaacaag tcccccatgc tttttctttt ctaaagctct      2400
     tggcagtgtg gttttttttt taaaaacaaa aaac                                  2434
//


spacer
spacer