Dbfetch

ID   AK039505; SV 1; linear; mRNA; HTC; MUS; 2479 BP.
XX
AC   AK039505;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male spinal cord cDNA, RIKEN full-length enriched
DE   library, clone:A330052B03 product:type 1 tumor necrosis factor receptor
DE   shedding aminopeptidase regulator, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2479
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8cb1153f8636b8a9c56f6954a166cbda.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A330052B03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2479
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A330052B03"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..626
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="type 1 tumor necrosis factor receptor shedding
FT                   aminopeptidase regulator (MGD|MGI:1933403 GB|NM_030711,
FT                   evidence: BLASTN, 100%, match=716)"
FT                   /db_xref="GOA:Q8CA64"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR033520"
FT                   /db_xref="MGI:MGI:1933403"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CA64"
FT                   /protein_id="BAC30371.1"
FT                   /translation="ACVRNYQPCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNT
FT                   EGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTL
FT                   IGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSS
FT                   LKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL"
XX
SQ   Sequence 2479 BP; 742 A; 474 C; 485 G; 778 T; 0 other;
     tcgcatgtgt gcgcaattat cagccctgtg tgcagagggc agagcgctat ttcagagagt        60
     ggaagtcatc taatggaaac atgagcatcc ctattgatgt gaccttggct gtgtttgctg       120
     tcggggccca aaacacagaa ggctgggatt ttctttatag taaatatcag tcttctttgt       180
     ctagtactga gaaaagccaa attgaatttt ccctctgtac aagcaaagat ccagaaaaac       240
     ttcagtggct tctagatcaa agttttaagg gagagataat aaaaactcag gaatttccac       300
     atattctcac actcattggc agaaacccag tgggttatcc attggcctgg aagtttctga       360
     gggaaaattg gaataagctt gtacagaaat ttgaacttgg ctcatcgtcc atagctcaca       420
     tggtaatggg aacaacagac cagttttcca ccagagcacg tcttgaagag gtaaaaggat       480
     tcttcagttc cttgaaagaa aacggttctc agctccgttg tgttcaacaa accattgaga       540
     ccattgaaga aaacatacga tggatggata agaattttga taaaataaga ctgtggctgc       600
     aaaaagaaaa gccagagttg ctgtgacaat atgtttcttg ccaagttcca gaatttatga       660
     tgagcaaaat tttgttcaat ttgagtattt ttaaactaaa gatagttgtt ttggctacta       720
     ctgaagatat tttcttattt catttcactt gattatgtct gagaaaagct tcaatgactg       780
     tgattgacag gtttaaaccc aagtgcccag ctccttgcca cagaaaaacc cagggggctt       840
     cttctcagtt tatacttcag cttctgtgtc ggccattcat cagtattttt gtaagactga       900
     atagtgaggc ataactgtgc agtgaatgct tggctcctta gccatgctgg gaagtggctg       960
     tgcagcagcc ctcctgttga cctctctggc tctacagtcc tgcagtctct cttcctgggt      1020
     tcacttatgg gtgctgcctt gcaggatcca cttaatcaga cacttttgcc ctctggattt      1080
     tgttaatagt gtttggtagt tgttatccat gagggattgc atagaggtgt ttattttctt      1140
     gtacttgcct ctggctggct ttcaaccacc gtaagtctta ctcctaagag gtggcctttc      1200
     cccccccccc cccgcactct gataactact tccttttcat cctttggggc atggggcaac      1260
     agtggaaacc tgctgatacc agtcatggta gtacttgtca ttttcactga acctacgtgc      1320
     acatttgttt ttaaaaatat tgtatatcta taaccctcgt tggataagtc aaatatgaga      1380
     gccacttact ttctttggaa ggttattttt aaaaatgcag agtgcattca gatctgtatc      1440
     agaaatatct cgttttaaga tatacttgtg agtcactgat cccttaagta gggagtaggg      1500
     ttgtaaattc ctaaataact cataatagca cttactgaaa ataaatcatt gaggactcac      1560
     taacaaagga caatattaat aatatgttta tattagtata aggaaagatt ctttaaatct      1620
     taaaaagatt tttttgatgt atggcataaa tgataggaaa aatatcaaca tatggtgctg      1680
     taatatacta tgaaataaag cgattttagg ggttcaatta tattttcact ggcctaccaa      1740
     aatacttgag attaaatgag gaaagatttt agttgatggc ttgttggctc tgttattaaa      1800
     ggcctgtggt gagacactat ggctaccata acaggtatca gggaagaatg tttatccagt      1860
     attggccaga aaacaaaaca agagccagat agaagtctgg ggacacagtg tactggtcaa      1920
     agccatactc ccacagactg ggtctacttc ttcaattaca cctacccacc attcaagcat      1980
     gaatcatcag tgaattggtg acagcaaatg gattaatcca ctaaggagct cagcccttat      2040
     ggtcagtctc ctctgttact attaccacca ggtgggagcc aagacttcaa cacacgagct      2100
     cgcttggggg gggggggcac tttatatcta atccccaaca gatgtgttta tagttccatt      2160
     tttatattaa cttcatctga cagcttgaaa atagaaaatg attcactggt aatttttttt      2220
     ccccagacta catataaaat aaaacacata gccaagaact tcatgtaaaa tattttcctt      2280
     taattgaatt ttatatctta attaatgaaa cacaaatact gatttttgtt ttggtcacct      2340
     tcacttttgg aaaagcccat tttctaaaca gataaaatat tacatatgca gcaacttttt      2400
     gtaataaaaa ccatctgttc tttacttcta aggcaatatc tgcaattgtt ttcacctgac      2460
     taggatttta aaagtaaac                                                   2479
//