Dbfetch

ID   AK039458; SV 1; linear; mRNA; HTC; MUS; 2699 BP.
XX
AC   AK039458;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male spinal cord cDNA, RIKEN full-length enriched
DE   library, clone:A330045H06 product:signal transducer and activator of
DE   transcription 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2699
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a0a3ffba95ab4a813efb84f513c96ceb.
DR   Ensembl-Gn; ENSMUSG00000026104; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016006; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0015988; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0015944; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015945; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015777; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016396; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015358; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015748; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015849; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015851; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0015920; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015871; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016444; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015144; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015421; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000186574; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191435; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019740; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0019714; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0019674; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019667; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019493; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020166; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019004; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0019448; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0019563; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0019569; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0019650; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019540; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020223; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018758; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019089; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A330045H06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2699
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A330045H06"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             352..2490
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="signal transducer and activator of transcription 1
FT                   (MGD|MGI:103063, evidence: Direct assignment)"
FT                   /db_xref="GOA:Q99K94"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001217"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR012345"
FT                   /db_xref="InterPro:IPR013799"
FT                   /db_xref="InterPro:IPR013800"
FT                   /db_xref="InterPro:IPR013801"
FT                   /db_xref="InterPro:IPR015988"
FT                   /db_xref="InterPro:IPR035859"
FT                   /db_xref="InterPro:IPR036535"
FT                   /db_xref="InterPro:IPR036860"
FT                   /db_xref="MGI:MGI:103063"
FT                   /db_xref="UniProtKB/TrEMBL:Q99K94"
FT                   /protein_id="BAC30355.1"
FT                   /translation="MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEH
FT                   AAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMI
FT                   IYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEQEIKTL
FT                   EELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLN
FT                   SIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAETLQQIRQQLKKLE
FT                   ELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQ
FT                   FTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGS
FT                   LAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVI
FT                   SNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNAD
FT                   QLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDG
FT                   CIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYT
FT                   KKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELD
FT                   DPKRTGYIKTELISVSEV"
XX
SQ   Sequence 2699 BP; 742 A; 672 C; 684 G; 601 T; 0 other;
     gaggaggcgg gacgccctct agcctttttt cctgcccggt actttcggtt ttcagcgccg        60
     agtctgtcaa agctccctgg agacctccgg gaccgcgccc ctcagaccca cttgggacac       120
     tgctgagcgg cgcagagaga tttgcccaga ctcgagctcc tgcgtgcagt gagtgagtga       180
     gagccagtcg tttcagctct gctccatacc ctgagccggc gccacgccgc cgcgcatgca       240
     actggcatat aacttgctgt gtgtggtgat tgcttgtgtt gaatcccgaa cctgcacccg       300
     gagacagccc agtaagtcta cgtgggaacg gaagcatttg gaatctcaag gatgtcacag       360
     tggttcgagc ttcagcagct ggactccaag ttcctggagc aggtccacca gctgtacgat       420
     gacagtttcc ccatggaaat cagacagtac ctggcccagt ggctggaaaa gcaagactgg       480
     gagcacgctg cctatgatgt ctcgtttgcg accatccgct tccatgacct cctctcacag       540
     ctggacgacc agtacagccg cttttctctg gagaataatt tcttgttgca gcacaacata       600
     cggaaaagca agcgtaatct ccaggataac ttccaagaag atcccgtaca gatgtccatg       660
     atcatctaca actgtctgaa ggaagaaagg aagattttgg aaaatgccca aagatttaat       720
     caggcccagg agggaaatat tcagaacact gtgatgttag ataaacagaa ggagctggac       780
     agtaaagtca gaaatgtgaa ggatcaagtc atgtgcatag agcaggaaat caagacccta       840
     gaagaattac aagatgaata tgactttaaa tgcaaaacct ctcagaacag agaaggtgaa       900
     gccaatggtg tggcgaagag cgaccaaaaa caggaacagc tgctgctcca caagatgttt       960
     ttaatgcttg acaataagag aaaggagata attcacaaaa tcagagagtt gctgaattcc      1020
     atcgagctca ctcagaacac tctgattaat gacgagctcg tggagtggaa gcgaaggcag      1080
     cagagcgcct gcatcggggg accgcccaac gcctgcctgg atcagctgca aagctggttc      1140
     accattgttg cagagaccct gcagcagatc cgtcagcagc ttaaaaagct ggaggagttg      1200
     gaacagaaat tcacctatga gcccgaccct attacaaaaa acaagcaggt gttgtcagat      1260
     cgaaccttcc tcctcttcca gcagctcatt cagagctcct tcgtggtaga acgacagccg      1320
     tgcatgccca ctcacccgca gaggcccctg gtcttgaaga ctggggtaca gttcactgtc      1380
     aagctgagac tgttggtgaa attgcaagag ctgaactata acttgaaagt gaaagtctca      1440
     tttgacaaag atgtgaacga gaaaaacaca gttaaaggat ttcggaagtt caacatcttg      1500
     ggtacgcaca caaaagtgat gaacatggaa gaatccacca acggaagtct ggcagctgag      1560
     ttccgacacc tgcaactgaa ggaacagaaa aacgctggga acagaactaa tgaggggcct      1620
     ctcattgtca ccgaagaact tcactctctt agctttgaaa cccagttgtg ccagccaggc      1680
     ttggtgattg acctggagac cacctctctt cctgtcgtgg tgatctccaa cgtcagccag      1740
     ctccccagtg gctgggcgtc tatcctgtgg tacaacatgc tggtgacaga gcccaggaat      1800
     ctctccttct tcctgaaccc cccgtgcgcg tggtggtccc agctctcaga ggtgttgagt      1860
     tggcagtttt catcagtcac caagagaggt ctgaacgcag accagctgag catgctggga      1920
     gagaagctgc tgggccctaa tgctggccct gatggtctta ttccatggac aaggttttgt      1980
     aaggaaaata ttaatgataa aaatttctcc ttctggcctt ggattgacac catcctagag      2040
     ctcattaaga agcacctgct gtgcctctgg aatgatgggt gcattatggg cttcatcagc      2100
     aaggagcgag aacgcgctct gctcaaggac cagcagccag ggacgttcct gcttagattc      2160
     agtgagagct cccgggaagg ggccatcaca ttcacatggg tggaacggtc ccagaacgga      2220
     ggtgaacctg acttccatgc cgtggagccc tacacgaaaa aagaactttc agctgttact      2280
     ttcccagata ttattcgcaa ctacaaagtc atggctgccg agaacatacc agagaatccc      2340
     ctgaagtatc tgtaccccaa tattgacaaa gaccacgcct ttgggaagta ttattccaga      2400
     ccaaaggaag caccagaacc gatggagctt gacgacccta agcgaactgg atacatcaag      2460
     actgagttga tttctgtgtc tgaagtgtaa gtgagcacag aagactggct tgttcaggac      2520
     cgcaggccag ccccgtccct ggctgcggtc cattgattgc actggctcat ggctcatggc      2580
     ttgctttccc aatgtaactg atgttgccac cacagttgga cattctggaa agtttgtaac      2640
     tagtcctggt gtcaatgctt actggcattt tattgccatg agataaaaaa aaacaaact       2699
//