Dbfetch

ID   AK039161; SV 1; linear; mRNA; HTC; MUS; 3763 BP.
XX
AC   AK039161;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male hypothalamus cDNA, RIKEN full-length enriched
DE   library, clone:A230103M05 product:calcitonin receptor, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3763
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 42a649518be708bd305f0ab4100cb70c.
DR   Ensembl-Gn; ENSMUSG00000023964; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030422; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030395; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030404; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030118; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030859; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030096; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030240; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030194; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030230; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030889; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029234; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029596; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171613; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076140; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0076217; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0076122; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076157; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075780; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076631; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0075743; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0075892; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0075784; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0075941; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075806; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076866; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075781; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074911; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A230103M05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3763
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A230103M05"
FT                   /tissue_type="hypothalamus"
FT                   /db_xref="taxon:10090"
FT   CDS             500..2101
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="calcitonin receptor (MGD|MGI:101950 GB|NM_007588,
FT                   evidence: BLASTN, 99%, match=2772)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q60755"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="MGI:MGI:101950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60755"
FT                   /protein_id="BAC30261.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPMHIFHHNTHMWTMQWELSPPLPLSAHEGKMDPHASEVISCKVLHFLHQ
FT                   YMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYN
FT                   DNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKAT
FT                   MVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKR
FT                   QWTQFKIQWSQRWGRRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEE
FT                   STEMIPMNVIQQDASA"
XX
SQ   Sequence 3763 BP; 982 A; 913 C; 825 G; 1043 T; 0 other;
     ggctttttcc tggcttttgc ttgaacagtc aggaaaagaa gtgcccgctg atgcctggct        60
     gcacccagct ccggatagga ggtggaggat agcccgtcct tggaagcaac ttgctttcct       120
     cccagggtgc gcctgccagc ccagactgcg cccgcctgga atcagattgt cccgggctcc       180
     tgctggcttt cagtggagaa ggggaattgt cctcaacacc aagtcaggag agccagccgc       240
     ccaagactct gggcggactg cacctggctg gcttgcagac aactcttggt tggagaggtg       300
     cttacttctg cgcctcaccc tgccgttggc atcccctgcc tgcagatgcc cagtgaagtc       360
     tgcgttcctg agaacacctg agctgtgccc agacatccag caagagaatt cctgcatcca       420
     cctaaggtaa gtgccattag agcgccttcc agaggagaag aaaccgaggg agcagggcta       480
     ctacacagag gatttgaaaa tgactccaag gaggtccaga gtgaaaaggc ggaatctccg       540
     caaaccgaag atgaggttcc ttctcgtgaa caggttcacc ctgctgctcc tgctcctagt       600
     gagcccaact ccagttcttc aggctcctac caatctcact gactccggcc ttgatcagga       660
     gccattcctg tacttggttg gccgcaagaa gctgctggat gctcagtaca aatgctatga       720
     ccggattcat cagttgccct cttatgaagg agaaggtctg tactgcaacc gcacctggga       780
     tggctggatg tgctgggacg acactcccgc tggagccaca gcctatcagc actgccctga       840
     ctacttcccg gactttgaca cagcagaaaa ggtttcaaaa tactgtgatg aaaatggaga       900
     gtggtttaga caccctgaca gcaaccgaac ctggtccaac tatactctgt gcaacgcttt       960
     cacttctgag aaactgcaaa atgcgtacgt tctttattac ctggctcttg tgggtcactc      1020
     cttgtcgatt gctgctttgg ttgcttccat gctgatcttc tggattttca agaaccttag      1080
     ctgccagagg gtgaccttgc acaagcacat gttccttact tatattctga attctatcat      1140
     tatcatcatc cacctggttg aggttgtgcc caatggagat ctggtgcggc gggatcctat      1200
     gcatattttt catcataaca cacatatgtg gacaatgcag tgggaactgt caccaccctt      1260
     acccctgagt gcacacgagg gaaagatgga ccctcatgcc agtgaagtga taagttgcaa      1320
     ggttctacac tttttacatc agtacatgat gtcttgcaac tacttctgga tgctctgcga      1380
     ggggatctat cttcatactc tgattgtcat ggctgtgttt accgacgagc aacgcctacg      1440
     ctggtactat cttcttggct gggggttccc gatagtgcca accattatcc acgccatcac      1500
     tcgtgccctc tactacaacg acaactgctg gctgagtgca gaaacccact tgctttacat      1560
     catccatgga cccgtcatgg tggctctggt ggtcaacttc ttctttcttc tcaacattgt      1620
     ccgcgtgctt gtgaccaaga tgaggcaaac ccacgaggcc gagtcctaca tgtacctgaa      1680
     ggctgtgaag gccaccatgg tccttgtgcc cctgctgggg atccagtttg ttgtgtttcc      1740
     ctggaggccc tccaacaagg tgcttgggaa gatctatgat tatctcatgc actctctgat      1800
     tcatttccag ggattctttg tggcgactat ctactgcttc tgcaaccatg aggtgcaagt      1860
     caccctgaag cgccagtgga cgcagttcaa gatccagtgg agccaacgct ggggaaggcg      1920
     ccgccgcccc accaaccgcg tagttagtgc tcctcgggct gtagccttcg ctgagccaga      1980
     tggcctcccc atttacatct gccatcagga accacggaat cctccaatca gcaacaacga      2040
     aggcgaggag agtactgaaa tgatccccat gaacgtcatc cagcaagacg catccgcttg      2100
     aatgtgaagc caccccaagc attgtgatcc actgagcctt catttcctgg ggaaagacag      2160
     accatgtgtt tcaagtgatt cccatcctcc caggagctga ccatatcatt tgtgaagaag      2220
     tgttaagtga atttgtccat agtgaatttg aagaaagtga ttcttggtac tattgctttg      2280
     ggagtcagtc taggaataga gtctcccatt gcaacttgtg aactccatca ttcatcctgg      2340
     actgagatga ctgtgttcgt aggaaagcag gcaaggtgtt caaaagatgt cacactattg      2400
     acctagttca gatacagggt gctccttgtg aattttgagc catttgtacc gttgagaaat      2460
     taaaatcact ctcaatgttt ttaaatttga cactggattt tgaattagac tatttctgta      2520
     tttgactaca gatctggttt ttaatgtttt tatttcagtc agttcctata ttacacatgt      2580
     taccatccat acaatgtcaa ctacacatat agcatgacct ctgaaagatg gtgtgtcttt      2640
     tataacatga tccagttcac caggcagacc caaatgctgt aatgaattga tctgaacctt      2700
     gtatgtgctt tggtcactga catttataag ttgggaggtc accaagaacc tatcaccaaa      2760
     tttatcacaa aactgccctc caaaatgtaa caatctttaa agagagtttt ccactttcct      2820
     aaactacagg atttataaaa caaatcactc caaggtttat aaagcagatt acctcttgcc      2880
     cttgggtgct atctagcagt aagagaaaga tttgtttacg actggtaatt aaaagactcc      2940
     atacaagtcc attaactgcc ttccacccag cttcaaagct aaacaagatc cctgtgtttt      3000
     tcaagaagac tctgtgtggc taattacaaa tcagtttctt gttgacctct tgcttgctgc      3060
     tattagcaaa acaagagggg gaaaaaaccc acaatgtagg gacttcaaat ttaacctcat      3120
     attaattcat cttaaattaa aaacagagct tctcatcaaa acccagtact atatctccat      3180
     acccctcttt actccccagt aggagatcat ctaagatcca tgaataaacc aataccatca      3240
     cggatttctg aatctgcaac agtaaccagt catcattact taatttgtat gctaaatgag      3300
     gagctttttt gagaccctca aaatctcctc tcacctttgt aatcttttgt cactgccttt      3360
     cagaggtgat ttagttgtgt aaagacaaaa gtaacttgat ttgttctggt tacatgcttg      3420
     gtgtacccag agaaaactgt atttcaatag caactgtgga ccttggatac tgagagttgc      3480
     ctttaccaaa atggaaggac ggattgaagg aaggatgttt tttcaatcac agtgttacct      3540
     ggtgatgtcc ctatgttttg tttacacaca tcgaaatcag tgtatttcag gcagctctag      3600
     tacaaatgtg ataatatatt gaagtgtttg agatgttatt gtgcttatgt agtaggagct      3660
     gatgaaatca aactgactta ccataacatt gcatgtcata cctaaattgt gtgaaacgct      3720
     tctgctgtgt acatgtataa atacagagca tattaaaaag gcg                        3763
//