Dbfetch

ID   AK038620; SV 1; linear; mRNA; HTC; MUS; 2919 BP.
XX
AC   AK038620;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male hypothalamus cDNA, RIKEN full-length enriched
DE   library, clone:A230051A20 product:NOCICEPTIN RECEPTOR (ORPHANIN FQ
DE   RECEPTOR), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2919
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6c4f098dd7960f457e7b1b97c9f48f2e.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027036; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027002; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026972; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027010; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026752; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026866; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026832; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025947; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026283; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059991; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059927; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059607; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060383; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059899; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059579; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059686; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059651; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058879; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A230051A20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2919
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A230051A20"
FT                   /tissue_type="hypothalamus"
FT                   /db_xref="taxon:10090"
FT   CDS             178..1281
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="NOCICEPTIN RECEPTOR (ORPHANIN FQ RECEPTOR)
FT                   (SWISSPROT|P35377, evidence: FASTY, 100%ID, 100%length,
FT                   match=1101)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542U1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/TrEMBL:Q542U1"
FT                   /protein_id="BAC30067.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   regulatory      2896..2901
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2919
FT                   /note="putative"
XX
SQ   Sequence 2919 BP; 620 A; 734 C; 739 G; 826 T; 0 other;
     tggtgctcca gtgtgcctta ggatggtttg ggcatttttt tgtattcggc tgactgtgag        60
     cccctgagtc ttggtgggtg gacatgtatg cttgtgtagc tacctccatg ttgcttctgt       120
     gcgagtctat caccctaata tgaggaactg tactgagtgg ctttgcaggg tgacagcatg       180
     gagtccctct ttcctgcccc attctgggag gtcttgtatg gcagccactt tcaagggaac       240
     ctgtctctcc taaatgagac cgtaccccat cacctgctcc tcaatgctag ccacagtgcc       300
     ttcctgcccc ttggactcaa ggtcaccatc gtggggctct acttggctgt gtgcatcggg       360
     gggctcctgg ggaactgcct cgtcatgtat gtcatcctca ggcacaccaa gatgaagact       420
     gctaccaaca tttacatatt taatctggca ctggctgata ccctggtctt gctgacactg       480
     cccttccagg gcacagacat ccttctgggc ttctggccat ttgggaatgc actgtgcaag       540
     acggtcattg ctatcgacta ctacaacatg tttaccagca ctttcacttt gactgccatg       600
     agtgtagacc gttatgtagc tatctgccac cctatccgtg cccttgatgt tcggacatcc       660
     agtaaagccc aggccgttaa tgtggccata tgggccctgg cttcggtggt tggtgttcct       720
     gttgccatca tgggctcagc acaagtggag gatgaagaga tcgagtgcct ggtggagatc       780
     cccgcccctc aggactattg gggccctgta tttgccatct gcatcttcct tttttccttc       840
     atcatcccgg ttctgatcat ctctgtctgc tacagcctca tgattcgacg acttcgtggt       900
     gtccggctgc tttcaggctc ccgagagaag gaccggaacc tgcgacgcat cacacggctg       960
     gtactggtag ttgtggctgt gtttgtgggc tgctggacac ctgtgcaggt ctttgtcctg      1020
     gttcaaggac tgggtgttca gccaggtagt gagactgcag tagccattct gcgcttctgc      1080
     acagccctgg gctatgtcaa cagttgtctc aatcccattc tctatgcttt cttggatgag      1140
     aacttcaagg cctgctttag aaagttctgc tgtgcttctg ccctgcaccg ggagatgcag      1200
     gtttctgatc gtgtgcgcag cattgccaag gatgtaggcc ttggttgcaa gacctctgag      1260
     acagtaccac ggccggcatg actaggcgtg gacctgccca tggtgcctgt cagtccacag      1320
     agcccatcta cacccaacac ggagctcaca caggtcactg ctctctaggt tgaccctgaa      1380
     ctgagcgtct ggggccttga atggcttttc ttttggttca ggatgctcag tcctagagga      1440
     agacctttta gcaccatggg acaggtcaaa gcatcaaggt ggcctccatg gcctctgtca      1500
     gattaagttt cctccctggt ataggaccag agagaaccaa aggaactgca tggaaacatc      1560
     cacaactcag tggacatgcc tggtgaaccc atgtaggtat tcatggttca cttgactctt      1620
     ctctggtttc tccctgctgc cctggttcta ggtgggctca gcctgaggta ttgtagttgt      1680
     catgtagtca ctattgtgac tacctgttgt gtgctattgc cctcagcctt tcagtgtttg      1740
     cacagaactg gtgatcatac ccagtgttgc ctggccctta agcttggagt tgccttggag      1800
     catctagttc tgactccact gatgcattca gattacctga ggtgggtgag catcagtggg      1860
     ttcttggatg actgtttcct gacgattctt ttcatgctgt actatggagt atatgaaggg      1920
     gacttcacac ttcatctggt actgccactg cctgctctac caacctggac caccttctca      1980
     gcaagaggct agcaggggga caagacacaa agcttcccta aggctctttc cctccaaaac      2040
     cactgtgaac tcttattcta cagactgttt ggcaagccct gcttctaact gtgtgggaag      2100
     taatcaggag aaaattctgt ggcctctgta ggctgctcac agcatggagg caccacatgc      2160
     tggtcttggg tatgtgtctt ggctgctcag tatgggcagg gcagggcacg agactatgct      2220
     ctctccttat tctccacagc ctccctcagc tctccagcag tcgctctttt acttgacagt      2280
     agaggtcagc agttgtactg ctagaaacac acttgtagcc cgggaagact ggagtcagga      2340
     tgtgttctat tctataccca cagtgaccac ctgcttcatt tatagggtta ggacatatcc      2400
     aagcaaggcc tgggcttggc atcaaatgaa gagctggtat gagagctgaa gcctaaaatg      2460
     gctcatttga gccaatctgc aaggactatt acggttttgg ggacattgga agaagagtcg      2520
     ataccttgga gatatattgt tggttcacag aagaagaggc tttgtaaatg ccctttctat      2580
     gggtcagata aaaaaatacc agcaaccttg gatagaatct gatcttacac agagaccttg      2640
     gttaggtggt ttcatgccat gcagaaccca ggctggttcc tgtctcagag agacctggcc      2700
     ttaacaatct ttctggggag accagggttc tttcaatgac acttgtgcag gagccattag      2760
     ctctagtgtt ttcttgctaa tgctagaaac tttgtgaatt tgtatatctt tatgtattta      2820
     agcatgcaac aaatgtcatt ttcgtgcatg tagctagccc tgaacctgcc tctggggtaa      2880
     tgaaggagtt ctcataataa acacttacca gtgaccagc                             2919
//