spacer

EBI Dbfetch

ID   AK037554; SV 1; linear; mRNA; HTC; MUS; 4155 BP.
XX
AC   AK037554;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 16 days neonate thymus cDNA, RIKEN full-length enriched
DE   library, clone:A130026F16 product:IL2-inducible T-cell kinase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4155
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1ff65f9c4f5c17aa39453e742b6becd2.
DR   Ensembl-Gn; ENSMUSG00000020395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020664; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109237; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A130026F16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4155
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A130026F16"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1045
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="IL2-inducible T-cell kinase (MGD|MGI:96621
FT                   GB|NM_010583, evidence: BLASTN, 99%, match=3349)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8CAW3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:96621"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CAW3"
FT                   /protein_id="BAC29830.1"
FT                   /translation="YTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPL
FT                   LIQYHQYNGGGLVTRLRYPVCSWRQKAPVTAGLRYGKWVIQPSELTFVQEIGSGQFGLV
FT                   HLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFE
FT                   FMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQV
FT                   IKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSE
FT                   GKIPYENRSNSEVVEDISTGFRLYKPRLASCHVYQIMNHCWKEKPEDRPPFSQLLSQLA
FT                   EIAEAGL"
XX
SQ   Sequence 4155 BP; 1062 A; 1026 C; 1044 G; 1023 T; 0 other;
     ttacacagtc tctgttttca ccaaggccat cataagtgag aacccctgta taaaacatta        60
     tcacatcaaa gaaacaaatg acagccccaa gcgctactac gtggctgaga agtatgtgtt       120
     tgactccatc cctctcctca tccagtatca ccagtacaat ggaggaggtt tggtcactcg       180
     actccgctat ccagtttgct cctggagaca aaaagcccct gtcacagcag ggctaagata       240
     tgggaagtgg gtgatccaac cctcagagct aacgttcgtg caggagattg gcagcgggca       300
     gtttgggctg gtgcatctcg gctactggct caacaaggac aaggtggcca tcaagaccat       360
     tcaggaaggg gcgatgtcag aagaagactt tatcgaggag gcggaagtca tgatgaaact       420
     ctctcacccc aaactggtgc agctctatgg ggtgtgcctg gagcaagccc ccatctgcct       480
     ggtgtttgag ttcatggagc acggctgcct gtcggattac cttcgaagtc agcggggtct       540
     ctttgctgcg gagaccctgc tgggcatgtg cctggatgtg tgtgagggca tggcctacct       600
     ggaaaaagct tgtgtcatcc acagagacct ggcagccaga aactgtttgg tgggagaaaa       660
     ccaggtcatc aaggtgtccg actttgggat gacaagattt gtccttgatg atcaatatac       720
     cagctccacg ggcaccaaat tcccagtgaa gtgggcatcc ccagaggtgt tctcctttag       780
     tcgctatagc agcaagtcag atgtgtggtc gtttggtgta ctgatgtggg aagtcttcag       840
     tgaaggcaaa atcccatacg aaaaccgaag caattccgag gtcgtggaag atatcagcac       900
     tggctttcgg ttatacaagc cccgcctggc ctcctgtcat gtctaccaga tcatgaatca       960
     ttgctggaaa gagaaaccag aagaccggcc acccttctcc cagctgttaa gccagctggc      1020
     tgaaatcgca gaagctgggc tttagcaggg actcattgac cagacacagc cataaatcct      1080
     gagtgaagga acaatgtcct ttttccagag cattaaaagc tgccaccagt ccagaaaccc      1140
     ccacaggtgc ctggaccatg gtgccagcac ctatgcagcc acaactgcag catcatagaa      1200
     aagggtggag ggccggccac tgagccaaca gctgaaccac aactggagca gtatctgcgt      1260
     gtccacccca tcccagcctc ttgtcgtatg ctgtactcaa agctccattg cccactctcg      1320
     ggagcatccc ctccccctct tagcaatcag gagaggcaga cgtaggccac actcttcttt      1380
     attattactt ttaagaataa ttcaagtaac ctttaatttg gcccaacgag acattgtgcc      1440
     cattttatgg atggaagagc gggaaagcat cattcttttt ctaagaaatg caagaggtga      1500
     ttaaaccagg gtgttctact acttcaaggc tgtcagccac agcttcctgc ctcacatgag      1560
     gcggagcgga tgcttgtgcc agaggccgga tgccataagg tttcagagca cactgccacc      1620
     tctctttgat ggggcacaga gagctccacc gggtggatag ggcagggtga cacattcaga      1680
     ccccacggca ggaccacagg atgtctgagg tcggtcagga atgagagggc ctctgatggt      1740
     ggaagtaaag agctgcaaaa gaagcctttg ggttgtccct gacccagcgg ccctgtttca      1800
     cggtgagtca tgtgtgtgac tggatctcct gttctgtgca ggatgctgaa gcagtgacta      1860
     cagaacggtc atcattccag cctctcagga gcggcatcca ctcagcactg tcatgatcct      1920
     tgtgactttg agactttggg ttctttcaag cctttacggg ttcagcagtc ttaaggttgc      1980
     catgtaaggc tctcaagagc ccagcaaagg aagaaggcgt ttgctcttgc ccaaactatc      2040
     aggaaggaaa gaggcaagca ctgggcggtg cttccaaaat gcacaggatg tctcctactg      2100
     attggcactc gcacaggtga catgtgtata tcctgcacac aggtcatccc tggcgaatca      2160
     cagttcatac caacccaacc acgaggtatt attcatgtct tacagaaagt ggacttggtc      2220
     ttttaaaagc tggatagctg ccccagtgac agaactggga aggacggaga ttgagatgac      2280
     acccgaatat aactccagtg tagcctctta gctcttctca atgctgcctc ctactgaggt      2340
     tgggccgctg agcgcataac acaggaaagt ctgggttaat gggcacccca ccccacagcc      2400
     aagttgctcc tactcagagc actggggggc ccagtgggac cctccaaatt gaaataggct      2460
     gttctctttc ttcaccctca cctggatctg agttcacaac cctggagcca ctcaaaatta      2520
     accctttcat tctcccaacc taccagagtc acattgcctg aggccattta tactagagct      2580
     tcaaaggtgc tttcaactag tctcctgcag actgtttcct gtaattatcc cttcaaccta      2640
     gagctggctc tcttgtgaga aggaggattc cctggtgcca ggcacactgg attttcctgc      2700
     ggtgttcaga caaagcccct agaaaaatga tcagagtcac agatccctct tcctaagtca      2760
     cgtggcattt aggctggctt gaggctcaaa tgcatcactt ccaactgtaa tcactgtgtc      2820
     cagataaaac tctgtcattc agaaaatgaa cttcctcaac tggtccacaa tcatctctgt      2880
     ttattctctt ttgggaaacc ttaattaaga gacgatttct gggacatcca atctggaaga      2940
     taaacactgg aaccgagaga agtctgtggt gtggtttagg agactggccc ccatacggtg      3000
     gtattggctc tcttaacctc acatgcacga aggctttgat ggacgcgtgt gcactgctta      3060
     ctccagtgtc ctgcttggga agatgggatt ctcttctgct ggtttctgtc ttacattttt      3120
     tttgtaaatg gtgccctgtg ttcacagaaa ggttttggtt tgaaatgtat tttgtaggcc      3180
     ttgcaattca taatgtttgg aactatgtat ttatgcctag atcaggagag tatttattgc      3240
     ttgtcttcat gataaaaaat actgcaggta tgtcttaccc tctgtggggg ccaccaagtc      3300
     aatcattgct tatggaaaaa aatatatata taaagctaca tgttttacaa gtataggccc      3360
     tgtgacttga gttccaggtt cctgacacct cactttgctt acgtaaaaat ggtcacgtgg      3420
     tttcctgtgg ctcatgtgga aggcacaggg tgggcaaggg ttggagcagc acattgacca      3480
     ggcctttgct cttacccggt acttggcgga ggagattaaa aagtggaaag gattagagtt      3540
     ggtcatggag cccaagttat ggtttgtgcc tcccaacctg cgggtggggg gggggggaga      3600
     aggagagacc agattacagc caaaggctgt cccaggtggc ccctgtgctc aaggagcgca      3660
     tcgtgaggaa gggaaccatg atgatcagct accagtccca tgggaccctg gccaacttct      3720
     tccgactggt ggtggccaac accatactgt cccgggccat tatagatttc cttctgggca      3780
     agctagagcg cctgggccag gacctgcgag ctgcttcccc tctctgtctc acccaatctc      3840
     tgcatcatct cctgggttca caaaaacaat ctttcaagga aacagtggcc ttgactgtgt      3900
     gtgctcccac acactaactc tcccagttaa gtattgagtg tcaggaaggt gtctaaacac      3960
     gctacagtat gctcttatga aatatgcttt tattaagttg ggcatagggg cacacacctt      4020
     taaaccaaca ctggggaggc agaggcaggc agatctctga gtttgaggcc agcctggact      4080
     acacagctgg gctattccga gaaactctgt ctcaaaaaga taaaagaaaa aagaagaaaa      4140
     gaaagaaaag atagg                                                       4155
//


spacer
spacer