spacer

EBI Dbfetch

ID   AK037487; SV 1; linear; mRNA; HTC; MUS; 2566 BP.
XX
AC   AK037487;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 16 days neonate thymus cDNA, RIKEN full-length enriched
DE   library, clone:A130021C19 product:N-myc downstream regulated 3, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2566
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 16b6f93d463bae493edb7155c4dff2ff.
DR   Ensembl-Gn; ENSMUSG00000027634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072298; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A130021C19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2566
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A130021C19"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             85..1212
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="N-myc downstream regulated 3 (MGD|MGI:1352499
FT                   GB|NM_013865, evidence: BLASTN, 100%, match=2553)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q544I1"
FT                   /db_xref="InterPro:IPR004142"
FT                   /db_xref="MGI:MGI:1352499"
FT                   /db_xref="UniProtKB/TrEMBL:Q544I1"
FT                   /protein_id="BAC29818.1"
FT                   /translation="MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVT
FT                   IRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSF
FT                   PTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINI
FT                   DPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENL
FT                   QLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPIN
FT                   TTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGE
FT                   SPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC"
FT   polyA_signal    2541..2546
FT                   /note="putative"
FT   polyA_site      2566
FT                   /note="putative"
XX
SQ   Sequence 2566 BP; 666 A; 650 C; 598 G; 652 T; 0 other;
     gggctgctgt agattgacgg ccccgcgcta gcgcttcaga gttcctggtt catccttgag        60
     actcatctgc tctgagccat cctcatggat gaacttcagg atgttcaact cacagagatc       120
     aaaccgcttc taaatgataa gaatggcaca cgaaacttcc aggactttga ctgtcaggaa       180
     catgacattg aaacaccgca tggtatggtc cacgtcacca taagaggctt accaaaagga       240
     aacagacctg ttatcctgac ataccacgac attgggctca accataagtc ctgcttcaac       300
     acattcttca actttgagga tatgcaagag atcacccagc actttgctgt ctgtcacgtg       360
     gacgctcctg gccaacaaga agcagcaccc tccttcccca cagggtacca gtaccccacc       420
     atggatgagc tagctgagat gctgcctcct gttctcacac acttaagtat gaagagcatc       480
     attggtattg gggttggagc aggagcctac attctcagca gatttgcact gaatcatcca       540
     gagctggtgg aaggtcttgt gctcattaac attgacccgt gtgctaaggg ctggattgac       600
     tgggcagctt ccaaactctc aggttttacc accaacattg tggacataat tctggctcat       660
     cactttggcc aggaggagtt gcaggccaat ttggacctca ttcaaaccta cagactgcac       720
     attgctcaag atatcaacca agaaaacctc cagctcttcc tgggttccta taatgggcgc       780
     agagacctgg agatcgaaag gcctatactg ggccaaaatg ataacagatt gaaaacgcta       840
     aagtgttcta ccttactggt ggtgggggac aattcacctg ctgtggaggc tgtggttgaa       900
     tgtaattctc gcctcgaccc tataaataca actttgctaa agatggcaga ctgtggagga       960
     ctgccccaag tagttcagcc tgggaagctc accgaggcct tcaagtactt tttgcaggga      1020
     atgggctaca taccatctgc cagcatgacc cggctcgccc gatcacgaac ccactccacc      1080
     tcaagtagca ttggctctgg agaaagtccc tttagcaggt ctgtgaccag caatcagtca      1140
     gatggaactc aagaatcctg tgagtcccct gatgtcctgg acagacacca gaccatggaa      1200
     gtgtcttgct aagcagatct cctcccctgg accatgcaag tccctctcct tgaaatgacc      1260
     actccgtaat agaacatttc attccgtcag ctggccccca cttcctttca ctcacgcatg      1320
     gccacagcat ctctctctag tagccgagag tgtcattctc tccacccttt ctgtgtgtac      1380
     cagagccaca cccatgccat tactgtaaca ttccaacatc tccatctgac ctgacctcca      1440
     tatcttctct tgccagcctt tccctatgct ccctcaaata tgtatctgat gagattcttt      1500
     aattcccaac tccatgtgtg tgcgagcacg cgtgtctgtg tctgtgtgtg catacttctg      1560
     tgactttaga catgctttct tgtagtgctt ctgcaaaggg actttttttg aatcctcagt      1620
     ggcatttttt taagggaaat atgcagagtg gatatctggg tgggttgggc cacaagattg      1680
     gattttggtt ccacttggac aacaaacagt atttgcagag tgatttcagg agagagcagg      1740
     tctgaggaat atgcaaaact gtagttactg tgtgggccat tgactgcctt gaccagtaga      1800
     agggataact attacacaga taggcaggca gggtggcagt cacctcccct gtccacgtgg      1860
     atccatccct gccattgtgt gagtcagagg gatagatctg aagcctgtga atgatgtctg      1920
     gtacaccaca gtgttttctc cagagaactg gcctaagctc tagattagcc aagaaagctg      1980
     gaaaacagag cgccaggctt cactctgcag agagaaagtg ctctgtccct gtagcgtctg      2040
     attccactta ccagacaccc acgcatctgc aggatgtctg atgcagagcg gttctccatc      2100
     cctcagttcc agaaaaaatg gagtgatatt taaaaatgcc atcgatggtg gggatcttac      2160
     tggggaagag gaaggaccat tagcacacca tcatgatgtc agatgacaaa atggaagcca      2220
     agacaccttg aaggtgactt tctaggaagg tcttaagcat gtaatgtccc tttatcagag      2280
     ggaaggggac aaactcaggg cagccctgtc caggtagaaa tatttttgcc cccctgtctg      2340
     atgttgatga ggggtcatac cagccaggga gaccctctgg gaggaagctg ccacacacaa      2400
     ggactctgga agtatccaga tgtgagccca gccagggtcc tatggttcca aatctgaaga      2460
     aaaggttttt cacacactcc ttgctttctg ctaagataag aaaggcgtca ctctgccaga      2520
     gtgtgacttt ttacagatta aataaagctg tatatgtctc attgtc                     2566
//


spacer
spacer