Dbfetch

ID   AK037180; SV 1; linear; mRNA; HTC; MUS; 1961 BP.
XX
AC   AK037180;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus 6 days neonate skin cDNA, RIKEN full-length enriched library,
DE   clone:A030006O18 product:sprouty 4 (Spry4) mRNA, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1961
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fa8cba6a3037aa01e2b5df120d32e650.
DR   Ensembl-Gn; ENSMUSG00000024427; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024365; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024332; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024301; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024332; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024098; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024774; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023573; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024068; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024198; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024164; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024282; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024195; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024823; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023317; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023636; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025295; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049523; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049505; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049466; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049467; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049199; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049949; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049301; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049129; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049226; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049350; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049202; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050064; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048899; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048492; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A030006O18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1961
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="6 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A030006O18"
FT                   /tissue_type="skin"
FT                   /db_xref="taxon:10090"
FT   CDS             222..1124
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="sprouty 4 (Spry4) mRNA (GB|AF176906, evidence:
FT                   BLASTN, 99%, match=1325)"
FT                   /db_xref="GOA:Q9WTP2"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="InterPro:IPR030790"
FT                   /db_xref="MGI:MGI:1345144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTP2"
FT                   /protein_id="BAC29739.1"
FT                   /translation="MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMK
FT                   TSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSS
FT                   STSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEAC
FT                   GKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCAD
FT                   HPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
FT                   VICKAASGDTKTSRSDKPF"
FT   regulatory      1933..1938
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1961
FT                   /note="putative"
XX
SQ   Sequence 1961 BP; 409 A; 601 C; 513 G; 438 T; 0 other;
     gatcgccgct gaggcagcga acagagctga cagcgcggag ctggcgctgc agggctcagg        60
     gagctttgcc ggctcctccg actgacgtct gcgacttcaa cggcgactga cccactcggg       120
     ttcggggatt tacacagacg tggagcgatg cttgtgactc tgcagctcct caaagacccc       180
     tagaagcctg tcccttggtg cagttcagga cctccagcct catggagccc ccggttccac       240
     agagcagcgt ccctgtgaat cccagctcag tcatggtgca gcccctcctt gacagcagag       300
     cgccccacag ccggctccag cacccactca ccatcttacc cattgaccag atgaagacca       360
     gccacgtgga gaatgactac atagacaacc ctagcctggc ccctgccacg ggtcccaagc       420
     ggccccgggg cgggccacca gagctggctc ctacacctgc ccgctgtgac caggatatta       480
     ctcaccactg gatctccttc agcggtcggc ccagctctgt aagcagcagt agcagcactt       540
     cctccgacca gaggctccta gatcacatgg ctccaccgcc cgtggctgag caggcctcac       600
     ccagggctgt gcgcctccag cccaaggtgg ttcactgtaa gccgctggac ctcaaaggcc       660
     cgacagctcc gccagagcta gacaagcact tcttgctgtg tgaggcctgt ggaaagtgta       720
     agtgcaaaga gtgtgcgtcc cctcggacgt taccttcctg ctgggtctgc aaccaggagt       780
     gcctgtgctc ggctcagacg ctggtcaact atggcacatg catgtgtctg gtgcaaggta       840
     tcttctatca ctgtactaat gaggatgatg agggctcttg cgccgaccac ccctgctcct       900
     gttccggctc caactgctgc gcccgctggt ccttcatggg cgccctctct gtggtgctgc       960
     cctgtctgct gtgctacctg ccggccacag gctgcgtcaa gctggcccag cgaggctacg      1020
     accgcctgag acgccccggt tgccgctgca agcacacgaa cagcgtcatc tgcaaggcag      1080
     ccagtgggga caccaagacc agcaggtctg acaagccttt ctgacacttt ggataaaaaa      1140
     aacatggtcc ctcctgccag tctcctgaga ctgaccttgc tcatctgtcc tctcctaaaa      1200
     ccctagattg ggaagaaacc ggcagagaac actactgcct agccttgagt ccccaaaagg      1260
     atgaagatgt actttgggga ttttcacagt cttgaaactt tgttaaacag cagtgacagt      1320
     gttagggtat ggtggtaggg ggcccagttt tcctatttca gaagacggaa gacagatgcg      1380
     gacacagggt ctgcaagttc agccactcaa tggccttccc agcccctctg cttcctctca      1440
     ttttgccatt ctctctggct cctgctggag ccttctacct gggaggaaca gctaatggga      1500
     ggcaagatac ctcgaggaag accctccgag ccttgacttc tatctttgcc gcctccgtcc      1560
     atgcctgttg gccttggcct cttgggaagg tgcaccgtag ccattcctgc tgtatgcact      1620
     tgatgtccga gaacaaaatc gccggtaagc tgctgcctcc cgtgagtagc aggatggaga      1680
     aggaaccacc tggcagtgtg ttcctcctag ctttcaatca ctaacttggg ggttgtccgc      1740
     tcatcacgcc atcctccagt tcacagactg gcctgcctgc tatgcgtcct gagcactctt      1800
     tctactcgga ttctttgtag aaactcgctg ggttaagaag gccaggatga cacaagcaag      1860
     accaaatatc attttgccaa tgagtctgag gctgtggtct ctggatccag ccatgatgtt      1920
     tttatatgtt taattaaact agatgctatt ggtgtttaaa c                          1961
//