spacer

EBI Dbfetch

ID   AK037058; SV 1; linear; mRNA; HTC; MUS; 2472 BP.
XX
AC   AK037058;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult female vagina cDNA, RIKEN full-length enriched library,
DE   clone:9930105B05 product:hypothetical Sodium/hydrogen exchanger 3
DE   containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2472
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e44cf60f17054133f3cac0bce8011434.
DR   Ensembl-Gn; ENSMUSG00000031129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033463; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9930105B05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2472
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9930105B05"
FT                   /tissue_type="vagina"
FT                   /db_xref="taxon:10090"
FT   CDS             155..2089
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Sodium/hydrogen exchanger 3 containing
FT                   protein (InterPro|IPR004709, evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BZ00"
FT                   /db_xref="InterPro:IPR002090"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018416"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="MGI:MGI:2679732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BZ00"
FT                   /protein_id="BAC29688.1"
FT                   /translation="MAGQLRFTSGKDEDHFQHQGAVELLAFNFLLILTILTIWLFKNHR
FT                   FRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVYNCGNLFFSPSTLLVNITDQVYEY
FT                   KYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSIL
FT                   TYAFLGTAISCVVIGLIMYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSATDPVTVLAI
FT                   FHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQSVGNFLGI
FT                   FAGSFAMGSAYAVVTALLTKFTKLREFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLF
FT                   CGVTQAHYTYNNLSSDSKLRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILG
FT                   AFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPK
FT                   QMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVDLDESLKEEPSSQQEANKLDKNMT
FT                   KTESAQLFRMWYGFDHKYLKPILTHSGPPLTTTLPAWCGPVSRLLTSPQAYGEQLKEDD
FT                   VECIVNQDELAMNYQEQSPSPSSPTTKLALDQKSSGQTPGKENIYEGDLGLGGYDLKLE
FT                   QTRGQPQMD"
XX
SQ   Sequence 2472 BP; 634 A; 624 C; 568 G; 646 T; 0 other;
     ggctaagcca tctgaattgc ttgcgaagta gcaacaaagt agcagcgttt attctgaaat        60
     tctgtgggcg ccagtctatc ctaggcaacc ctcatctaag ggctcatccc ttgtccaggg       120
     atttctctga gcatcacagt cggtcgagtg gagaatggct gggcagcttc ggtttacgtc       180
     agggaaggat gaagatcatt ttcaacacca gggagcagtg gagctactcg cgtttaattt       240
     tttgctcatc cttaccattt taacaatctg gttatttaaa aatcaccgat tccgcttctt       300
     gcatgagact ggaggggcga tggtgtatgg cctcataatg ggactaattt tgcgatatgc       360
     cacagcgccg actgatattg atagtggaac tgtctacaac tgtgggaact tgttcttcag       420
     cccatcaact ctactagtca acatcaccga ccaagtttat gagtataagt accagagaga       480
     gatcaaccag cacaatatca gcccccacca aggcaacgcc atactggaga agatgacgtt       540
     tgacccagaa atcttcttca acgttttgct gcctcccatc atatttcatg caggatacag       600
     tctgaagaag agacactttt ttcaaaactt gggatccatt ttaacatatg ccttcttggg       660
     aacagccatc tcctgtgtgg tcatagggtt aattatgtac ggctttgtga aagccatggt       720
     gcatgctggc cagctgaaga gcggagactt ccacttcact gactgtttat tttttggttc       780
     actgatgtct gctacagatc cagtgacagt gctggccatt ttccatgaac tccacgtgga       840
     cccagacctg tacacactgc tgtttggaga gagtgtactg aatgatgcgg tggccatagt       900
     cctcacatac tctatatcca tctatagtcc caaggagaat cccaacgcgt ttgacacggc       960
     agcgttcttc caatccgtgg gcaatttcct agggatcttt gccggctcct ttgcaatggg      1020
     ctccgcatat gcagttgtta ccgcactgtt gaccaaattt accaagctcc gtgagttccc      1080
     gatgctggag acaggcctgt ttttcctcct ttcttggagt gccttcctgt ctgcagaggc      1140
     cgccggctta acaggcatag ttgctgttct cttctgtgga gtcacacagg cacattacac      1200
     ctacaacaat ctgtcatcgg attccaaact gaggaccaaa cagctgtttg aatttatgaa      1260
     cttcctggct gaaaacgtca tcttctgcta catgggcctg gctctgttca ccttccagaa      1320
     tcacattttc aatgctcttt ttatactcgg agcctttcta gcaatttttg ttgccagagc      1380
     ctgcaacatt taccccctct ccttcctcct gaatctgggc agaaagcaga agattccctg      1440
     gaacttccag cacatgatga tgttttcagg tttgcgaggt gccattgcct tcgccctggc      1500
     catccgcaac acggaatctc agcccaaaca gatgatgttc accaccacac tgctccttgt      1560
     gttcttcact gtctgggtgt ttggaggagg aacgaccccc atgctgacgt ggcttcagat      1620
     cagagttggt gtggacctgg atgaaagtct gaaggaagag ccctcctcac agcaggaagc      1680
     aaataagttg gacaaaaaca tgacgaagac agagagtgca cagctcttca gaatgtggta      1740
     tggatttgac cacaaatacc tgaaacccat cctaacacac tcaggccctc cactgaccac      1800
     caccttgcca gcgtggtgtg gcccagtctc caggctgctc accagtccgc aggcctatgg      1860
     ggaacaactg aaagaggatg acgtggaatg tatcgtcaac caagatgaac tggccatgaa      1920
     ttaccaggag cagagccctt cacccagcag tcccaccacc aagctagctc tggaccagaa      1980
     gtcttcaggc cagactccag gcaaggagaa tatctacgag ggagatctcg gcctgggagg      2040
     ctatgatctc aaactggagc agactcgggg tcaaccccag atggactaat tggtatgatg      2100
     agtgcagact taatcacatg taacacaaga ccactgagga atgccaacag ccaaggaggt      2160
     ggtgcagaga gagacagaaa gagtattaag aacatgaatt ggacagaatc aaaccttatc      2220
     acatgtatcc tcccgtgcct tcagaaatga gaattcatta tcttccctct gtattatgca      2280
     acctcattta attatctgac agccattttt actgctgaat taggggccag gagagtcagg      2340
     tcctagctgc cattgggatg aaccatatgt gctgtgtctg cagggggccc cttctgttcc      2400
     tcagacagct ctccaggccc ttcatgtgga ttttggattc aattccatta attatggaac      2460
     attaataaca tg                                                          2472
//


spacer
spacer