spacer

EBI Dbfetch

ID   AK036919; SV 1; linear; mRNA; HTC; MUS; 4009 BP.
XX
AC   AK036919;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult female vagina cDNA, RIKEN full-length enriched library,
DE   clone:9930024J01 product:solute carrier family 27 (fatty acid transporter),
DE   member 4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4009
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 83f117e8a3573ee96a1a6fa4bdd55196.
DR   Ensembl-Gn; ENSMUSG00000059316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080065; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9930024J01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4009
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9930024J01"
FT                   /tissue_type="vagina"
FT                   /db_xref="taxon:10090"
FT   CDS             290..2221
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 27 (fatty acid transporter),
FT                   member 4 (MGD|MGI:1347347 GB|AF072759, evidence: BLASTN,
FT                   99%, match=1500)"
FT                   /db_xref="GOA:Q91VE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="MGI:MGI:1347347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VE0"
FT                   /protein_id="BAC29639.1"
FT                   /translation="MLLGASLVGALLFSKLVLKLPWTQVGFSLLLLYLGSGGWRFIRVF
FT                   IKTVRRDIFGGMVLLKVKTKVRRYLQERKTVPLLFASMVQRHPDKTALIFEGTDTHWTF
FT                   RQLDEYSSSVANFLQARGLASGNVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRD
FT                   ALRHCLDTSKARALIFGSEMASAICEIHASLEPTLSLFCSGSWEPSTVPVSTEHLDPLL
FT                   EDAPKHLPSHPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDI
FT                   VYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRY
FT                   LLNQPPREAESRHKVRMALGNGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDSR
FT                   VGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGQPGQLVGRIIQQDPLR
FT                   RFDGYLNQGANNKKIANDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVS
FT                   TTEVEGTLSRLLHMADVAVYGVEVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLY
FT                   ARPIFLRFLPELHKTGTFKFQKTELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAYTR
FT                   IQAGEEKL"
XX
SQ   Sequence 4009 BP; 817 A; 1124 C; 1145 G; 923 T; 0 other;
     gcggggctgg gttgcgctga ggtgcacgga ctcagaagct cgccctctgc ggggacggca        60
     cagaaggcgg tgctgccggc tggcacagcc ggtgcgggtg cgggaggcgg gtgggggtgg       120
     agcggggcaa aggtacagac cctacaagga cgaggagtgg gccagacgca ccgaggctcg       180
     gctgtgtgtg ccccggggcg gccgatgccc ccagcgcacc gcactccgct gccgcaaccg       240
     ggccgcatcc tgacggggcg ccgcgccgcg cagccgcagc cgggtcacaa tgctacttgg       300
     agcatctctg gtgggggcgc tactgttctc caagctagtg ctgaagctgc cctggaccca       360
     ggtgggattc tccctgttgc tcctgtactt ggggtctggt ggctggcgtt tcatccgggt       420
     cttcatcaag acggtcagga gagatatctt tggtggcatg gtgctcctga aggtgaagac       480
     caaggtgcga cggtaccttc aggagcggaa gacggtgccc ctgctgtttg cttcaatggt       540
     acagcgccac ccggacaaga cagccctgat tttcgagggc acagacactc actggacctt       600
     ccgccagctg gatgagtact ccagtagtgt ggccaacttc ctgcaggccc ggggcctggc       660
     ctcaggcaat gtagttgccc tctttatgga aaaccgcaat gagtttgtgg gtctgtggct       720
     aggcatggcc aagctgggcg tggaggcggc tctcatcaac accaacctta ggcgggatgc       780
     cctgcgccac tgtcttgaca cctcaaaggc acgagctctc atctttggca gtgagatggc       840
     ctcagctatc tgtgagatcc atgctagcct ggagcccaca ctcagcctct tctgctctgg       900
     atcctgggag cccagcacag tgcccgtcag cacagagcat ctggaccctc ttctggaaga       960
     tgccccgaag cacctgccca gtcacccaga caagggtttt acagataagc tcttctacat      1020
     ctacacatcg ggcaccacgg ggctacccaa agctgccatt gtggtgcaca gcaggtatta      1080
     tcgtatggct tccctggtgt actatggatt ccgcatgcgg cctgatgaca ttgtctatga      1140
     ctgcctcccc ctctaccact cagcaggaaa catcgtgggg attggccagt gcttactcca      1200
     cggcatgact gtggtgatcc ggaagaagtt ctcagcctcc cggttctggg atgattgtat      1260
     caagtacaac tgcacaattg tacagtacat tggcgagctc tgccgctacc tcctgaacca      1320
     gccaccccgt gaggctgagt ctcggcacaa ggtgcgcatg gcactgggca acggtctccg      1380
     gcagtccatc tggaccgact tctccagccg tttccacatc ccccaggtgg ctgagttcta      1440
     tggggccact gaatgcaact gtagcctggg caactttgac agccgggtgg gggcctgtgg      1500
     cttcaatagc cgcatcctgt cctttgtgta ccctatccgt ttggtacgtg tcaatgagga      1560
     taccatggaa ctgatccggg gacccgatgg agtctgcatt ccctgtcaac caggtcagcc      1620
     aggccagctg gtgggtcgca tcatccagca ggaccctctg cgccgtttcg acgggtacct      1680
     caaccagggt gccaacaaca agaagattgc taatgatgtc ttcaagaagg gggaccaagc      1740
     ctacctcact ggtgacgtcc tggtgatgga tgagctgggt tacctgtact tccgagatcg      1800
     cactggggac acgttccgct ggaaagggga gaatgtatct accactgagg tggagggcac      1860
     actcagccgc ctgcttcata tggcagatgt ggcagtttat ggtgttgagg tgccaggaac      1920
     tgaaggccga gcaggaatgg ctgccgttgc aagtcccatc agcaactgtg acctggagag      1980
     ctttgcacag accttgaaaa aggagctgcc tctgtatgcc cgccccatct tcctgcgctt      2040
     cttgcctgag ctgcacaaga cagggacctt caagttccag aagacagagt tgcggaagga      2100
     gggctttgac ccatctgttg tgaaagaccc gctgttctat ctggatgctc ggaagggctg      2160
     ctacgttgca ctggaccagg aggcctatac ccgcatccag gcaggcgagg agaagctgtg      2220
     atttccccct acatccctct gagggccaga agatgctgga ttcagagccc tagcgtccac      2280
     cccagagggg tcctgggcaa tgccagacca aagctagcag ggcccgcacc tccgccccta      2340
     ggtgctgatc tcccctctcc caaactgcca agtgactcac tgccgcttcc ccgaccctcc      2400
     agaggctttc tgtgaaagtc tcatccaagc tgtgtcttct ggtccaggcg tggcccctgg      2460
     ccccagggtt tctgataggc tcctttagga tggtatcttg ggtccagcgg gccagggtgt      2520
     gggagaggag tcactaagat ccctccaatc agaagggagc ttacaaagga accaaggcaa      2580
     agcctgtaga ctcaggaagc taagtggcca gagactatag tggccagtca tcccatgtcc      2640
     acagaggatc ttggtccaga gctgccaaag tgtcacctct ccctgcctgc acctctgggg      2700
     aaaagaggac agcatgtggc cactgggcac ctgtctcaag aagtcaggat cacacactca      2760
     gtccttgttt ctccaggttc ccttgttctt gtctcgggga gggagggacg agtgtcctgt      2820
     ctgtccttcc tgcctgtctg tgagtctgtg ttgcttctcc atctgtccta gcctgagtgt      2880
     gggtggaaca ggcatgagga gagtgtggct caggggccaa taaactctgc cttgactcct      2940
     cttagcctga cagcctggct ccttgcctac ctccttcccc tctagcccct ttcgcttagc      3000
     ccttgggata agcccttagc cagtcctctt ttccaaagct ctgccttcct ataactcctt      3060
     aggagagact cccaccagat ctgacaggat gttaaacttt ggaacttaac ctttaaagta      3120
     agcatgtggc tttgggcaag tgtctcctga attatggggg taattaaggg attcagaaac      3180
     tacacaaagc cattaggagt gggaggatac ttggcgtctt tgagggaaag ccctcccctg      3240
     cacagaactg tccatggacc catgcgctgt tgctccatct tctgccaaat gacccattgg      3300
     agcctcccca gccctctgag gctttctatg aaagtttcat gtctaagctc tgtcttcttg      3360
     gccaggaggc ctctgcaccc gggctgagac tgacggcacc tttaggatga tgcatctgat      3420
     ccagacagac tgcctgacct cctcaggcaa ccctagccag tcagcagcac attggtccag      3480
     agtcctccag cctgggagtc cctgggaagt acagagggtc ctaacagccc agggtggact      3540
     gctcaagggc cctcctccac tgttggacct tctcctgtat ctgtgaggtc aatttcttga      3600
     gttctgagat ggttttgtgt ggtcctgatt gccattttac ttgggtacga tgtggagaat      3660
     ggctttgacc tcaggatctt tctgcttcct cccaggtgct gggatgaaag acatctggct      3720
     tgagtggttt tgttgtggtt atgtgcgcat gactcaggtt tctgcaaaca tgagtccaga      3780
     ggcctcagaa tcccctggag ctggaattaa aggggggggg ggttctagga gctaacctgg      3840
     gtctcaaagc acattttttt gggggggggt gttgattggt gttcaagaca cagtttctct      3900
     atgtaacagc tctgaactta caaagatccg cctgctccag agtgcagaga ttaaatgtgt      3960
     accaccacca ccctggcttg aagcaggtct tataaatgga ctattcaag                  4009
//


spacer
spacer