spacer

EBI Dbfetch

ID   AK036328; SV 1; linear; mRNA; HTC; MUS; 3890 BP.
XX
AC   AK036328;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 16 days neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:9630058F14 product:PHOSPHATIDATE CYTIDYLYLTRANSFERASE 2 (EC
DE   2.7.7.41) (CDP-DIGLYCERIDE SYNTHETASE 2) (CDP-DIGLYCERIDE PYROPHOSPHORYLASE
DE   2) (CDP- DIACYLGLYCEROL SYNTHASE 2) (CDS 2) (CTP:PHOSPHATIDATE
DE   CYTIDYLYLTRANSFERASE 2) (CDP-DAG SYNTHASE 2) (CDP-DG SYNTHETASE 2) homolog
DE   [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3890
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 12c7492cd33b093a0c4e0a9a6b62db65.
DR   Ensembl-Gn; ENSMUSG00000058793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103181; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9630058F14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3890
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9630058F14"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             148..1482
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="PHOSPHATIDATE CYTIDYLYLTRANSFERASE 2 (EC 2.7.7.41)
FT                   (CDP-DIGLYCERIDE SYNTHETASE 2) (CDP-DIGLYCERIDE
FT                   PYROPHOSPHORYLASE 2) (CDP- DIACYLGLYCEROL SYNTHASE 2) (CDS
FT                   2) (CTP:PHOSPHATIDATE CYTIDYLYLTRANSFERASE 2) (CDP-DAG
FT                   SYNTHASE 2) (CDP-DG SYNTHETASE 2) homolog [Homo sapiens]
FT                   (SWISSPROT|O95674, evidence: FASTY, 96.2%ID, 100%length,
FT                   match=1332)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q99L43"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="MGI:MGI:1332236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99L43"
FT                   /protein_id="BAC29384.1"
FT                   /translation="MTELRQRVVREDAPPEDKESESEAKLDGETASDSESRAETAPLPT
FT                   SVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKC
FT                   FHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSK
FT                   YHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMI
FT                   WFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMS
FT                   GYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIA
FT                   LSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASF
FT                   IRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILTSALEDE"
XX
SQ   Sequence 3890 BP; 804 A; 974 C; 1059 G; 1053 T; 0 other;
     gggggctagt ggcgctgctg caggggctgt gcgaggcacg gtggggctgc gaggtgctcg        60
     ggcccgccga gagcccgtgc tcactgagcc gacccccgcg gccaccgtgc tgctcactcg       120
     gggtgacgtc gcgccggggt ccccagcatg accgaactac ggcagagggt tgtccgcgag       180
     gacgcacctc cggaggacaa ggaatcagag tccgaagcaa agctagatgg agagacagcg       240
     tctgacagcg agagccgagc ggaaacagct cccctaccaa cctccgtaga tgacacccca       300
     gaggtcctta acagggccct ttccaacctg tcctcaaggt ggaagaactg gtgggtgaga       360
     ggcatcctga ctttggccat gatcgcgttt ttcttcatta tcatttacct gggaccaatg       420
     gttttgatga tgattgttat gtgtgtccag attaagtgtt tccatgaaat aatcactatt       480
     ggctacaatg tataccactc ctacgacctg ccctggttca ggaccctcag ctggtacttc       540
     ctgctgtgtg tgaactactt cttctatggg gagacagtga cggactactt cttcactctg       600
     gtccagagag aggagccttt gcggatcctc agtaaatacc accggttcat ctcctttgcc       660
     ctgtatctga caggattctg catgtttgta ctgagtctag ttaagaagca ttatcggctg       720
     cagttctaca tgtttggctg gacccatgtg accttgctta ttgtcgtaac gcagtcacac       780
     cttgttatcc ataacttgtt tgaaggaatg atatggttta ttgttcccat ctcgtgcgtc       840
     atctgcaatg acattatggc ctatatgttt ggctttttct ttggtcggac cccactcatt       900
     aagctctctc caaagaagac ctgggaaggc ttcattgggg gcttctttgc cactgtggtg       960
     tttggccttt tgctctccta tgtgatgtct gggtacagat gcttcgtgtg tcccgtggaa      1020
     tacaacaatg acaccaacag cttcactgtg gactgtgagc cgtctgacct attccgcctg      1080
     caggagtaca acatccctgg ggtgatccag tcggccattg gctggaaaac ggtgaggatg      1140
     taccctttcc agatccacag catcgccctc tccaccttcg cctcgctcat cggccctttc      1200
     ggagggttct tcgccagtgg attcaaacgg gcctttaaaa tcaaagattt tgccaatacc      1260
     attcccggtc atggaggcat catggatcgc tttgactgcc agtacctgat ggccaccttt      1320
     gtcaatgtgt acatcgccag ctttatcagg ggtccaaacc caagcaaact gatccagcag      1380
     tttctgacgt tgcggccaga tcagcagctt cacatcttca acacgctcaa gtctcaccta      1440
     actgacaagg ggattctgac atctgccttg gaagatgagt agagtccacc tggggcccag      1500
     agagctggag caggatggag tgggggccag tcgccaaggc cgcccagctg ctgtgactta      1560
     gataatgaaa agcttcaact caccaccgtc attttttttt ctttttcctt tttgtgcgtg      1620
     tgtggttttt aatctgtata tactgtctgt ttatagtgtg ggcagtgagt aagctgtagc      1680
     tttgagttgc aaagaagtca caggaaagaa ccatttgggt ttctgaagta caagtattga      1740
     gcaacatgaa gggcagtgtt gcccagctca gggtgtctgc ttggtggctc taacccctgc      1800
     ccatccagtt gtttctgggc tgtgcgagag atcatacatt gatctgtgtg tgatgagttg      1860
     agggctttcc cacctgcacg ggccttcacg ggctccacgc ttttgctgtc cttgacacct      1920
     ctcgttgggg cttctgcagg catctctgtc tgagagcagt gggggctgcc ctctgtagag      1980
     ctgtgagagc agtgggggct gccctctgta gagctgtgag agcagtgggg ggctgccctc      2040
     tgtagagctg tgagagcagt ggggggctgc cctctgtaga gctgtgagag cagtgggggc      2100
     tgccctctgt agagctgtga gagcagtggg ggctgccctc tgtagagctg tgagagcagt      2160
     gggggctgcc ctctgtagag ctgtgaggga gaggctttct gatcagatga acatctgtcc      2220
     aagccaaaat tctgcagagg gcaggtgagc tttgcttatg tagtttgctt tcaccatata      2280
     gactgagaga agatttcaga cttctttttc tcagaaagca tgaagaattt atgaagtatg      2340
     gaaaagaagc ccttacatat tccagatgtg tgcagcaggg ggcactgtcc cagccctctc      2400
     tgccccagcc aggcacagtg gcctctagag ggtggtcctg tagaccgcac cttttagagt      2460
     cgaggcctct gtggttgtgc cgcgggtttg ctgctgtgct gagtccttct gggggagccc      2520
     taagaggtgg ggagcagagg acttttgctc agacaccctt tgcctggaag cccacttgtg      2580
     ttgctgctgt gttgtgtata tagtattctc gagatgagcg tatgtgtgtc tgtttaaaag      2640
     tcaccttgtt tcctacatga ttttagtcat acccaaacgt cctcagaatc cctacatcct      2700
     gcttagaact gtggccggcc taatctgtca agaggcttgg ctcttcaaga ctcagtgtcc      2760
     actttatcaa atgtgaccgg tgtagctgta gtttgtactt tcctggggac cttctgctgg      2820
     ggtttgtgta agctgtgatt ctttcccttc ctaataggtt gagcttgaca tggaaaggag      2880
     cagttggcag ggaaggaact tattccccaa gagtggtaac taacccacag ccctgctcgg      2940
     tgtgcccacc gctgagaggc tgcagtgact tccccaagta ccgtggtctg tgctaatttg      3000
     ttttcagatt agtcttcctg tggcctccaa cactcagcca gccctcagag tgtccgctgt      3060
     gcgcacgggg gcggggcggg gcgggcagct ccttgtctct cagctttgac tgacttgtcc      3120
     gcattgggga tttttgttct cagctcccag gccgcactga acacagtgtt gctgccttca      3180
     gtttggttct ggccatgagg cccctagtgg gagctttgcc cttagggctg tcctctgact      3240
     tgccctcaaa gttcaccaat tcggcaactc catggagacg gtcgtgtcac tctcagcccc      3300
     tgttgctatt aagtcatgtc atgggcaccc ggaaaaggaa atacactgag gtgtatttta      3360
     caattgctcc ttaagattct cagtggagat taggagcaac actgcacttc tgatagaaaa      3420
     atggccttgg atcactaaac taggtagaga agggcacacc acaccccagc gccccaggag      3480
     ccaaaactca cgctcgggca gcagcagctg aggcttgagg aagctggtgt cctaagacac      3540
     tgaaacccag tgctcattgg agctgccagc cacaggtttc tattctgagt tctccagtct      3600
     tgtgaaagag gagaatttcc cagtcaggta gccaggagaa cagtgccacc ctgcgattgt      3660
     gccaccctgt gattgtatag cgtgttgttt gttccagtaa gcaggcaggc ccagagactg      3720
     ctttctcagc accgcacaga tctcagtggg tcacataact tgctttacac tcatcttgtt      3780
     gtgtcagaaa taaagtgttc gtgcttttcc ttgtcaggag tcccgtgttt gtcacttgtt      3840
     gtgtggtttt atgtttcccg ctgtgtgagc ataaacactg tgcagtttcc                 3890
//


spacer
spacer