spacer

EBI Dbfetch

ID   AK036141; SV 1; linear; mRNA; HTC; MUS; 2681 BP.
XX
AC   AK036141;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 16)
XX
DE   Mus musculus 16 days neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:9630039A18 product:UDP-Gal:betaGlcNAc beta
DE   1,3-galactosyltransferase, polypeptide 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2681
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 02eca9a8da85ae9a47d09588ac99ea48.
DR   Ensembl-Gn; ENSMUSG00000033849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038252; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9630039A18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2681
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9630039A18"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             771..2039
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,
FT                   polypeptide 2 (MGD|MGI:1349461 GB|NM_020025, evidence:
FT                   BLASTN, 99%, match=1269)"
FT                   /note="putative"
FT                   /db_xref="GOA:O54905"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1349461"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54905"
FT                   /protein_id="BAC29317.1"
FT                   /translation="MLQWRRRHCCFAKMTWSPKRSLLRTPLTGVLSLVFLFAMFLFFNH
FT                   HDWLPGRPGFKENPVTYTFRGFRSTKSETNHSSLRTIWKEVAPQTLRPHTASNSSNTEL
FT                   SPQGVTGLQNTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQ
FT                   IEARRAIRQTWGNETLAPGIQIIRVFLLGISIKLNGYLQHAIQEESRQYHDIIQQEYLD
FT                   TYYNLTIKTLMGMNWVATYCPHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGY
FT                   LMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLE
FT                   DVYVGICLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQ
FT                   NKHNACANAAKEKAGRYRHRKLH"
XX
SQ   Sequence 2681 BP; 908 A; 535 C; 506 G; 732 T; 0 other;
     tcgttaaatt ctgctctgtc agagacagca tctgtcaagc ccacatttaa actgctgcct        60
     gcctgtgcag cacggaagaa cggtgcattt cacattacag accaaaaccc caggaaaaca       120
     gctcaaaaat ccttcctgca gctgccaggc aaccacgacg gagaaaggca aagccttttt       180
     ttttccccca atgcaactga aacactaaac cacagctctg ctgcttaaca ttgcagctca       240
     gcgctattac tagaaatatg gatactgaga agagaataca gcactgcatt gtccagccgg       300
     gaatacagca gatgtaaaga gcttcaatgc atcaactgtc ggaaagagtc aactgtgcac       360
     caaatacaac agacagctac agctcttttg tttagtgaaa gagagaaaat gaaagaaagg       420
     aaaaatctct gaagactata agatatagac atatgaacaa gaagggtaac ttgaagacac       480
     cccgacagat ggacactttg gatactgtga aaagcaatca caggaggcag actgttgggg       540
     gatgtgcgca tgttcgatag catcgttttt tgctgaagtg atggcgtgcc aaaagtattt       600
     tcagtagaca taatcctctc catctaatgg tctgaccaag aaagaaagaa tgacatcgag       660
     ggacatgtac ctgaaccaga agacgatgaa tcaagcgcag tattgactga ggacggaaca       720
     acagtgtttt tggccacaga catccattac tgctactgga tacttacaac atgcttcagt       780
     ggagaagacg acactgctgc tttgcaaaaa tgacctggag ccctaagagg tctctgctcc       840
     ggactcccct tacgggtgtg ctttctctag tgtttctctt tgctatgttc ttgtttttca       900
     atcatcatga ctggttacca ggtagaccag gattcaaaga aaatcctgtg acatacactt       960
     tccgaggatt tcgttctaca aaaagtgaga caaaccatag ctcccttcgg accatctgga      1020
     aagaagtagc tcctcagact ctgaggcctc acacagcaag caactccagt aacaccgagc      1080
     tatcaccaca gggagtcaca gggctgcaga acactctcag tgccaatggc agcatttata      1140
     atgaaaaagg aactggacat ccaaactctt accatttcaa atatattatc aatgagcctg      1200
     aaaaatgcca agagaaaagt ccatttttaa tactattaat agctgcagaa cctggacaaa      1260
     tcgaagcaag aagagctata cggcaaactt ggggcaatga aactttggca cctggcatcc      1320
     aaatcatacg ggtttttttg ttgggcataa gtattaagct aaatggctat cttcaacatg      1380
     caattcaaga agaaagcaga cagtatcatg atataattca gcaggaatat ttagatacat      1440
     actataatct gaccattaaa acactaatgg gtatgaactg ggttgcaaca tactgtccac      1500
     atactcccta tgttatgaaa acggacagtg acatgtttgt caacacagaa tacttaatac      1560
     acaagttact aaagccagac ctgcctccta gacataacta ttttactggc tatctaatga      1620
     gaggatatgc accgaacaga aacaaagaca gtaagtggta catgccacca gacctttacc      1680
     caagtgagcg ctaccctgtc ttctgctcag gaactggtta tgtgttttct ggggatctgg      1740
     cagagaagat atttaaggtt tctttaggta tccgtcgttt gcacttggaa gatgtatatg      1800
     tagggatctg tcttgccaag ttgagagttg atcctgtgcc ccctcccaat gagttcgtgt      1860
     tcaatcactg gcgagtttct tattcaagct gtaaatacag ccacctaatt acctctcatc      1920
     agttccaacc tagtgaactg ataaaatact ggaaccattt acaacaaaat aagcacaacg      1980
     cctgtgccaa tgcagcaaag gaaaaggcag gcaggtatcg acaccgcaaa ctacactaga      2040
     agactatttt tgttcaaatg tggagtctgt aaatattgct taaagcatgt atagttaaaa      2100
     acttgattat atacatagga caagttttag ttcaactcat cacataaagg aattcaaagc      2160
     tattttttaa attttctgaa taagataatt catacaattg caaattatga caaaaaggta      2220
     tcccaaaaga gtctatttaa ataactgtta tgaggagatt ctctatatta acatgcaata      2280
     ataagcatgc atacataaat ggttcaagac ttacattagg gaccaataca atgtatctgc      2340
     atacattttc tatataaatc ttaagaaatg aagacagtaa aaagattcct agatttactt      2400
     ttgatttcat catataacta aatgtaaata agacagtact attgatttta aaggaacttt      2460
     gtaattgtgc aatgaacaag ttttctgacc tgactcagtt gcaataagat ttagttaagt      2520
     tattccataa actcatttat agcattcagg tgtttgagca atgcaattct cattcaagaa      2580
     tatactttta aaaataattt ataattattt taatttcttt tattaatact tatctatact      2640
     gggaaaatta ttttgacatg atgtgataaa tgtgaaaaac t                          2681
//


spacer
spacer