Dbfetch

ID   AK035971; SV 1; linear; mRNA; HTC; MUS; 3845 BP.
XX
AC   AK035971;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 16 days neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:9630022J22 product:solute carrier family 22 (organic anion
DE   transporter), member 6, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3845
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0da51a03915dea813970add757b86b52.
DR   Ensembl-Gn; ENSMUSG00000024650; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024801; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024769; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024744; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024769; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024535; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025216; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024008; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024509; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024636; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024603; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024723; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024630; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025265; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023753; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024070; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000010250; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050949; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050933; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050888; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050880; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050622; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051379; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050760; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0050561; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0050654; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0050623; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050784; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050616; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051494; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050349; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049909; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9630022J22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3845
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9630022J22"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             119..1756
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 22 (organic anion
FT                   transporter), member 6 (MGD|MGI:892001 GB|NM_008766,
FT                   evidence: BLASTN, 99%, match=2065)"
FT                   /db_xref="GOA:Q8VC69"
FT                   /db_xref="InterPro:IPR004749"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:892001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VC69"
FT                   /protein_id="BAC29261.1"
FT                   /translation="MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIP
FT                   AHHCRPPANANLSKDGGLEAWLPLDKQGRPESCLRFPFPHNGTEANGTGVTEPCLDGWV
FT                   YDNSTFPSTIVTEWNLVCSHRAFRQLAQSLFMVGVLLGAMMFGYLADRLGRRKVLILNY
FT                   LQTAVSGTCAAYAPNYTVYCIFRLLSGMSLASIAINCMTLNMEWMPIHTRAYVGTLIGY
FT                   VYSLGQFLLAGIAYAVPHWRHLQLAVSVPFFVAFIYSWFFIESARWYSSSGRLDLTLRA
FT                   LQRVARINGKQEEGAKLSIEVLQTSLQKELTLNKGQASAMELLRCPTLRRLFLCLSMLW
FT                   FATSFAYYGLVMDLQGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQLASLLLA
FT                   GICILVNGIIPRGHTIIRTSLAVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTM
FT                   ARVGSIVSPLISMTAEFYPSIPLFIFGAVPVAASAVTALLPETLGQPLPDTVQDLKSRS
FT                   RGKQKQQQLEQQKQMIPLQVSTQEKNGL"
FT   regulatory      3820..3825
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3845
FT                   /note="putative"
XX
SQ   Sequence 3845 BP; 944 A; 1025 C; 910 G; 966 T; 0 other;
     gactcagctg cagaggcagt ggcagcccta ctcctcaggc aaagggcagc agacagacag        60
     acagaggtcc taggactgga ggtcctcagg cattgaccac tcagcctggc ccagccccat       120
     ggccttcaat gacctcctga aacaggtggg gggtgtcgga cgcttccagc tgatccaggt       180
     caccatggtg gttgctcccc tactgctgat ggcttcccac aacaccctgc agaacttcac       240
     tgctgctatc cccgctcacc actgccgccc acctgctaat gccaacctca gcaaagatgg       300
     aggtctggag gcctggctgc ccctggacaa gcaaggacga cccgaatctt gcctccgctt       360
     tcctttcccg cacaatggca cagaggccaa tggcaccgga gtcacagagc cctgccttga       420
     tggctgggtc tatgacaaca gcaccttccc ttcaaccatc gtgactgagt ggaaccttgt       480
     gtgctctcat cgggccttcc gccagctggc ccagtccctg ttcatggtgg gagtgttact       540
     gggagccatg atgtttggct acctggcgga caggctgggc cgtcggaagg tgctgatctt       600
     gaactacctg caaacagctg tgtcgggaac ctgtgcagcc tatgcaccca actatactgt       660
     ctactgcatt ttccggctcc tctcgggcat gtctttggct agcattgcaa tcaactgcat       720
     gacactaaac atggagtgga tgcctattca cacccgtgcc tatgtgggca ccttgattgg       780
     ctatgtctac agcttgggcc agttcctcct ggctggtatc gcctatgctg tgccccactg       840
     gcgccacctg cagcttgcgg tctctgtgcc ttttttcgtt gccttcatct actcttggtt       900
     cttcattgag tcagcccgct ggtactcctc ctctggaagg ctggacctca ccctccgagc       960
     cctgcagaga gtggcccgca tcaacgggaa acaagaagag ggggctaagc tgagtataga      1020
     ggtgctccag accagcctgc agaaggaact gactctaaac aaaggccagg cctccgccat      1080
     ggagctgctg cgctgcccca cgcttcggcg cctcttcctc tgcctctcta tgctgtggtt      1140
     tgccactagc tttgcctact acgggctggt catggacctg cagggctttg gggtcagcat      1200
     gtaccttatc caggtgattt tcggcgctgt ggacctgcct gccaagtttg tgtgcttcct      1260
     agtcatcaat tccatgggcc gccggcctgc acagttggcc tccctgctgc tggcaggcat      1320
     ctgtatccta gtgaatggca taataccgag gggccataca atcattcgca catccctggc      1380
     tgtactaggg aaaggctgtc tggcttcctc tttcaactgc atcttcctgt acaccggaga      1440
     gctgtacccc acaatgattc ggcagacggg cctgggcatg ggcagcacca tggcccgggt      1500
     gggcagcata gtgagcccac tgataagcat gactgccgag ttctacccct ccatacctct      1560
     cttcatcttc ggcgctgtcc ccgtggccgc cagcgctgtc actgccctgc tgccagagac      1620
     cttgggccag ccgctgcctg atacagtgca ggacctgaag agcaggagca gaggaaagca      1680
     gaagcaacag cagctggaac agcagaagca gatgatacca ctccaggtct caacacaaga      1740
     gaagaacgga ctctgaaaat ggagagggcg tcacacagca ctaaagggag tggggttctg      1800
     caggtcccac catctatgag gagggggagt gagtggaggg actgggccat ctaaatgcgg      1860
     agcctgccat tcagagaaat gcctccccaa aggtcacttc aatagaccta ctaggaacaa      1920
     aagctctaac tgtgtgcagc ttcttaagca gaatgagctc ttcctcagcc atcttccagc      1980
     tcagtggtca ctcctccagc tcctgtccct tccacctcca ggacattgca aagaatccca      2040
     gacaattaaa taaatttctt ctaccttggt ccctctctct tcttctctac ctctcctatc      2100
     caaccatttc tgttttaact acatgttttc tgtctcttcc ctttgcagaa atcagaattt      2160
     aatgagaaac tgaagtgaaa tcagcagtca gaggctctgc cctgggctct tctcctgctg      2220
     taagagcaga cagaaacttc tagcagcaaa agagatagat gcttataggc gtgatgtcag      2280
     gatcctgtcc cctgcaagtt cagaccacta gccaacctaa tctttcctgt gtttgatggg      2340
     ttttcaacgt tgctctgctt cctgtaggtt caggggctgg tggaggagtg agacgaggac      2400
     cagacagtat ttaacagcca gggagaccaa acactgagtg ttaattatat gccaggtggt      2460
     agcttcagca atttaaatgt attaattcag tttatcctct ttggtttcat tttcttagtt      2520
     ttcctgataa ggggtcttat ctagctagtt attttgttaa cttgacacag gctagagtca      2580
     tttgaaagga aagaacctca actgaaaaaa aatgtctcta taagtggcct gaaggcaagc      2640
     ctgtgcaggg cagattctta attaatgatc gatgtaggag gattcagacc actgttgaca      2700
     acactgcccc tgggatgatg gtcctgtttg ctataacaaa gcgagctgag caagccagtg      2760
     agcagtgttc ttccacagcc tctgctacag tctctgcccc gacttcccac catgtcagag      2820
     tgtgacctga gagctgtaag atgaaacaaa ccctttcctc tctaagtagc ttttggtcat      2880
     ggtattttgt cacagcaatg gaaatactaa gacagggtct catccctagc tggccttgac      2940
     ctgactaagt agctgagggt gactttgaac cttgagcctt ctgcctccac ctcccaaatg      3000
     caagcattcc aggcgtgtgc cgcaatgctc aaatctgaaa atagtaccct ttgattccta      3060
     tcttggtctc ttttcagtca gtgtgtcagg gaccttgtag catcttctgt gacttgacca      3120
     agatggaaca ctctgaattc tcaacttcct ggtcctggta gagttctcct cctgctcagg      3180
     gcttcacctc atcattgcag gttccacaca ggcttttagt ccaaagccct tccttacagg      3240
     atttttcctc cttcaaagat gtttcccgac cccagagaga tttagaggac agagtctcta      3300
     ccagctaagc ttcctgccct agatcaggct gtgcagagga accctagacg aggtctacac      3360
     aaactccttg gaactttcaa ttgtgtggcc taaaacataa atgacatgca gatataatta      3420
     aattaatgat ttcgaagtga agaaactatc ttaaattatt tgggttagcc caatatgatt      3480
     acaaaggcag ttagacagat cagtggacag cagatataac agaagaatca agagggtgga      3540
     gtgactcaag aaggaatgaa aaataaaaat cagttcaaga cagagacaat aagcttcaat      3600
     tagttgttag caaattaaag taacttctga tcattttcaa tcaaatagat acatttagca      3660
     ttatcaaatg aataaatatg tggtatgggc ctccaggcca aggaatgaaa cttccgggag      3720
     cttaaatagg aaggaaatgg attcttcttt gaaaccacca aaaggaacac atccctgttg      3780
     acatagcaac cttcaatatc cagcctctaa ctatacaaga ataaactgga ctgttttaag      3840
     cctcc                                                                  3845
//