spacer

EBI Dbfetch

ID   AK035893; SV 1; linear; mRNA; HTC; MUS; 2563 BP.
XX
AC   AK035893;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 16 days neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:9630015C03 product:RAS-RELATED PROTEIN RAB-6B homolog [Homo
DE   sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2563
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 3845dbb768906b7f30f85b5feaf5c2cb.
DR   Ensembl-Gn; ENSMUSG00000032549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035155; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9630015C03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2563
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9630015C03"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             43..669
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="RAS-RELATED PROTEIN RAB-6B homolog [Homo sapiens]
FT                   (SWISSPROT|Q9NRW1, evidence: FASTY, 100%ID, 100%length,
FT                   match=624)"
FT                   /note="putative"
FT                   /db_xref="GOA:P61294"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:107283"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61294"
FT                   /protein_id="BAC29230.1"
FT                   /translation="MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQAT
FT                   IGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQT
FT                   SKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNV
FT                   KQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC"
XX
SQ   Sequence 2563 BP; 641 A; 642 C; 630 G; 650 T; 0 other;
     gctcctcctc ctcctcctcg cccggcccca gctgccagca ccatgtccgc agggggagat        60
     tttgggaacc cgctgcgaaa attcaagttg gttttcctag gggagcagag cgtcgggaag       120
     acgtctctga tcacgaggtt catgtatgac agcttcgaca acacctacca ggcaaccatc       180
     gggattgact tcttgtcaaa aaccatgtac ttggaagacc gtacggttcg actgcagctc       240
     tgggacactg ctgggcaaga gaggttccgc agcctgatcc ccagctacat ccgagactcc       300
     acggtggctg tggtggtata tgacattact aatctcaact ccttccagca gacttctaaa       360
     tggattgatg acgtcaggac ggagaggggc agtgacgtga tcatcatgct tgtgggtaac       420
     aagacggatc tggctgataa gaggcagata accatcgagg aaggagaaca gcgggccaaa       480
     gaactgagcg tcatgttcat cgagaccagc gcgaagactg gctacaacgt gaagcagctc       540
     ttccgacgtg tggcgtcagc tctgcccggc atggagaatg tccaggagaa gagcaaagaa       600
     gggatgattg acatcaagct ggacaagcct caggagcccc cggccagcga gggcggctgc       660
     tcctgttaat gcaccgccca ctcggcttcc tcagcgccac tcacttgttt tgcctcctat       720
     agcttcctaa cggggtggga actgagttta tcaagactgg aggatctttc ttttctctct       780
     ctctctctct ctaggagtag ggtgggacat ggggagggag gctgggcatc agggaccacg       840
     tcactcttaa cagctgttac ctaaacaact attttttggt ttggttgtaa tatattgtac       900
     tttattaaga ttgccaaaaa ctgttaaaat ttaaaaaaaa aatttaaatc atgtgtatac       960
     aactttttgc cagattagaa aagtagtcat ttttatttga aagaagtgct tttttgtttg      1020
     tttgtttttg tatatttgta aacttacaga gaacctctcc acacacttct tccttcctgt      1080
     tctcttggaa ctgtgtgtca cctctatttt cctcctaccc ccgccccccc cagcccagaa      1140
     aattaaagca attaactgaa cagtagtaat tacattctag ttctgggtca catggcccaa      1200
     accaaccaaa cccgcactcc acagtcaaat ccaactttaa tctaacaaaa cagcctctga      1260
     gggggtattg tcgagttctt ccctggcaga gtgggacaca ttggcaggcc cctgagagga      1320
     gatgaaggcc cgtggactgt agattcagca gcagctcctt ggctgcttcc gcctcttctc      1380
     cttccctgaa aaaaataacc atagagccag aaagcacagg caacagtgtg ttctctgggc      1440
     tgacccggtg acagacagca agaagttact ggaaggatgg ggtgcgcttg gcagctgagg      1500
     gctgaggcag tgtgtaatct actggcccaa ccattgacac acatggttag gctgactcgc      1560
     caactcaatg tgtgatgctg ggtggctcag ggacactgaa gcctagggca cctgccatca      1620
     ctgcaactac cattgaggaa gtgagaggag tcggccatga ctccggacac tccatgttgt      1680
     cagacccttg gatactaatc ttgccgaacg ttgttctgga aaagctgatt ccttgatgtg      1740
     tcctcacctc tggcgtggta cgtttgaaat ctttgtatga atacctttgg gagtgttggc      1800
     agctgcactg cacgcatctt ggagtcactg tggggtttcc agaaggctgc tgccccaggg      1860
     tactgcaact tgccccccag caggctgtcc ttgctatttc cactcattcc ccagactgaa      1920
     gaccttcaga gtctcttagc agagtgctct tctcaaagca gaatagctct tatattctaa      1980
     acgctcccgg actcactgcc cctgtctgcc tttgggcagg cctggggcag tgactctaat      2040
     cagagcagcc tagccccata gcattggctc ttctttcaga ctgctggtgg gcagagtgaa      2100
     ttgcctccac aaggcagaac tccaacaagg aggttgggat gaattatgga atctctcaaa      2160
     gaatgagttc aaaatggcag cctgtgtggc agggctgatt ctgtgagtgg gcccgtcatg      2220
     cgactccatc ctgggagact gtgtcaaagc cggttctgat gatgaagaga ggaagcagga      2280
     ccgccctggg tacctcctcc agaaggcaag gaccaatgta cgagcataat cgaaacgtca      2340
     cgtgtttagt ttttatatgt gtgtacataa ttatacatag agatagactt gtgtatacac      2400
     ccttcgcgcg cacacataca cacactcaca tcctcacata tacatgtgct cagtgtatat      2460
     cctcgtctct cccgctcaca acttggaact tacattgtga ttccggtttt tggaagttca      2520
     aaagtatgca gtgtattgaa ataagaaata actcaatatt gtc                        2563
//


spacer
spacer