spacer

EBI Dbfetch

ID   AK035717; SV 1; linear; mRNA; HTC; MUS; 4798 BP.
XX
AC   AK035717;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male urinary bladder cDNA, RIKEN full-length enriched
DE   library, clone:9530095I18 product:DJ144C9.2 (SIMILAR TO WASF2 (WAS PROTEIN
DE   FAMILY, MEMBER 2)) homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4798
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d25dfe58b59bd44aa2d7f99dbfe2eb5a.
DR   Ensembl-Gn; ENSMUSG00000028868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105912; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9530095I18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4798
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9530095I18"
FT                   /tissue_type="urinary bladder"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..940
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="DJ144C9.2 (SIMILAR TO WASF2 (WAS PROTEIN FAMILY,
FT                   MEMBER 2)) homolog [Homo sapiens] (SPTR|CAC18518, evidence:
FT                   FASTY, 90.5%ID, 62.8%length, match=936)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8BZD7"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="MGI:MGI:1098641"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BZD7"
FT                   /protein_id="BAC29165.1"
FT                   /translation="PNRGNVNPRKIKTRKEEWEKMKMGQEFVESKERLGPSGYSSTLVY
FT                   QNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADNQRGSVLAGP
FT                   KRTSMVSPSHPPPAPPLSSPPGPKPGFAPPPAPPPPPPMSVPPPLPSMGFGSPGTPPPP
FT                   SPPSFPPHPDFAAPPPPPPPPAADYPMPPPPLSQPSGGAPPPPPPPPPPGPPPLPFSGA
FT                   DGQPAAPPPPPPSEATKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGN
FT                   DVATILSRRIAVEYSDSEDDSSEFDEDDWSD"
XX
SQ   Sequence 4798 BP; 1003 A; 1387 C; 1226 G; 1182 T; 0 other;
     tccaaataga gggaatgtga acccacgtaa aatcaagaca cgcaaggaag agtgggagaa        60
     gatgaaaatg ggacaagaat ttgtagagtc caaggagagg ctggggcctt ctgggtattc       120
     gtccaccttg gtgtaccaga atggcagcat tggctctgtt gaaaatgtgg atgcggccag       180
     ctacccacca ccaccacagt cggactctgc ctcctcacct tccccttcat tctctgaaga       240
     caacttgcct cccccgccag cagaattcag ctaccctgca gacaaccaaa gaggatctgt       300
     cttggctgga cccaaaagaa ccagcatggt cagcccaagc catccacccc cagctcctcc       360
     tctgagctct ccgccaggtc ccaagcctgg cttcgctcct ccacctgccc ctccacctcc       420
     acctcccatg agtgtgccac ctccactacc atcgatggga ttcgggtctc ctgggacccc       480
     tccaccccca tcacctccat ctttccctcc tcaccctgat tttgctgctc ctccaccacc       540
     tcccccacca ccagcagctg actacccaat gccaccacct cctttgtccc aaccgtctgg       600
     aggtgctcct ccgcctcctc ctccccctcc ccctccaggg cccccgcctc tccccttcag       660
     cggtgctgat ggccagcctg ctgcaccacc accaccacca ccttctgagg ccaccaagcc       720
     caagtcttca ttgcctgctg tgagtgacgc gcgcagtgac ctgctttctg ccattcgcca       780
     aggctttcag ctgcgaaggg ttgaagagca acgggagcaa gagaagcgtg atgtggtggg       840
     caatgatgtg gccaccatcc tgtcccgtcg gatcgctgtt gagtacagcg actcggaaga       900
     tgattcttct gaatttgatg aagacgactg gtcggattaa ctccgcctgc tgcccacatt       960
     cctctttcta gtcctcccac ctgccttcct ccatacaaac taacagtctc atggggggaa      1020
     gaaagcaagg gacaaagaac tgcaaggggc caaagccaaa gatctatccg agtgcttcct      1080
     tcaactgacc atatgcttct tcctcgtgtc tgcctgcggg ctcctgaggg tccacagctg      1140
     agctgatcca tctttccctc aagtgaccgt atctagtgac aggaagggag aaccctacag      1200
     tagatccctc tgcttgggtt tcaactggag atagtgcctt cccctgataa ccattttaac      1260
     ccatggcctt cgtcaaaacc ctttcattta gctacttcaa ataatgttat ccacctcctg      1320
     tctcacagca gtgggtacag cctgtgtggg cgcaggtggt cccttttctg tgccctgaca      1380
     agtagactgg cacactcctg ccccacactc agccttctgc agcaggtagg cttgcttctg      1440
     ttagctctgc ctggatgcct ttgttccaga aggcatcagg cctctaaaga ctgtctcaca      1500
     agtgatgccc ttctggagac tgagggtgtg gccttcctcc catgctctct ctgggtgagt      1560
     gtggggtctg ggtgtccttt gcattcccct cctcacccca ggtgccttaa gacagcccag      1620
     ttctaacctg atattcatga ccaaactagc cctgacactc agggacctgg gcctctgctg      1680
     actgtcagga gcaaaacttg aaggtgtggc accgcaggac tggaagagag tggaacacct      1740
     tgggtcctgc ctgttcaggg tactgaggcc aagatgagaa gtgactctct caaggtcaca      1800
     cagatagtga tagaacaaga gcccaggctt cctgctttcc aagtcacctg tgtttcctgg      1860
     gaccaaataa tgagcacctg ctggagtctg ggcagagcag cctggctccc ttctacccca      1920
     gagctcccaa atgccggcct tgcatttgga gggttcatgg cctgtgcggg gaggtggggg      1980
     ggggggctct ccggtgcagc tttaactgca gccgctctgg taagccgctc ttatttcccc      2040
     ttctgtctgc agccagtcat gtggcatggg agctgtgctg gggaggcagt gtacagagga      2100
     gctgtggggc agccaccctt ggccaggtgc agtttgcagt tcactgcagt tccctccccc      2160
     ttttgtttcc tcaatttaca gcagaggttg tgccagttgt acaaacttca gtccctcagg      2220
     ctggcagccg ctgcaggtac ctgcctgggg gggcctggca gccatggaga aggctgagag      2280
     gcagaaggac acggggtctt cctgcctcac caccttgctg tgcatgatga tgctgaccca      2340
     ccccctttac ctcccttccc agaactgata cacgggtgtt attattcagg aaaaaaactg      2400
     agcagctctg gccagcagca aggtttcttc tctactgccc caactattgt gtggcctctt      2460
     gtgctgaaat ctctggcttc agagcctgag acaaagagaa acaggatctg tctctaccca      2520
     gcacagcaaa tggttgtagt aattgccaaa gccctcataa acccctccgg cttgaggaga      2580
     gtgcaatcat ggctctgctg cctgcacttg ctgggttcct cccctctgcc tcctttcttg      2640
     aactcagagg tagggactaa gcaccaggtg ccagcaggcc ctcctgctgt ggccactcca      2700
     gagtgctccg tgtctccatg tgtccgtggc ctgccccccc ccaacccccc aaatccagtg      2760
     tctggcaccg ggtttggcag tcaactccat gctgtgcatg tttcccaccc cgtgccttag      2820
     aagctgaagg tgctttttca tcagaacctt aacatggctg ttgatggtac cctggctgca      2880
     gcccagcggg ggctggagag gcaggggagg gcagtggtcc ttccaaatag aagtcctggg      2940
     gcctggccag gccagggttt gggcctaatg gtttttacta aattactccc ctcctgctct      3000
     ccgagaaagg ggagccagag ccgctcactg tggttctgtt ccgaccttga aggggcggta      3060
     ttgggcctgg cttctggaat ggacagagtc caccaggaaa gactgggggc gggaggagct      3120
     ggggaggggc cctgtctgcg gaaggtagga ttagatcatt agctcagtga cctcctaggg      3180
     tttcgatgtg ctgtgttctc atcctacagc tggtttggta atgatctgca agtcccggag      3240
     agcaacagca cagctccgcc tgacgctctc attaaaatcc atgcagccaa gctctgcgct      3300
     ttgtagcagc cggccttgca gagcctcctc agcttggggg gctggggacc cagtcagctg      3360
     agaggtcctc taggctctac ttaggcatat gtgtacccaa aaaaaaaatt tttttttaag      3420
     catgcttctt ttaaacccag agccctttaa aataataaag aacccagtgc aggtgggtgt      3480
     gtttgtggaa tcccgtaagc gtagaatacc aagtttagtg actatttaaa ctgggctgag      3540
     gctggtaaga ctataaagca gtggcccata aggactctta agcgtgaggc caaggagcca      3600
     cgtcccttcc cagtctgcct ggcccagggg ggctgccccc attcctggag cccaggggcc      3660
     cagcttgcaa ttgctagtgt caggagtgac ttgtagcttt gccttggttg tgaaatgatt      3720
     tcattccagg ggagggggcg ggggatccct tggaggctca gagcagctgg cccaagctgc      3780
     agctcgtctc cagtggaggc ttgaatgccc tcagaaacga ccctggccaa tgtcaccgca      3840
     gagccgaggc ggtgttgtca gggctaatgt gaaatctctt cccgtggcgc cgatcctctg      3900
     actctatagc gccagcttgg acagattgag gtctctgtgg ctttggtgac cctgcttaag      3960
     cattcccacc gtgtccctgt tctgcgctag cactgcctcc tgctgcagcc cctgacttga      4020
     cctcagggcc tggggaggga agcaccatac cagggccagg agctccaact ccgacgtgtc      4080
     agcctctggg ggagggggga ttaagccttg agcttggctg gtgcccattg gacctgggac      4140
     caggtgttac ccagagaggt gcctctgctg tgcttcctgc ctccatcact ttcctagggc      4200
     ctccgtgagg gctgagaaca gctctgctct gctcctgtat tattaacttg cttcagttaa      4260
     ctgacttgag aaactaacca attgttacct tctgcctaga atgatgtaca cataggagag      4320
     gaagctatca tgttcccgaa gtgccttgtt ttctctgata ggaatatatt tataaggacc      4380
     tattccaata ggctcttggt gtttcccata tcaagatttc tgctagctaa tgcatagagg      4440
     gaatactgtc taaaaataga ccctttcttc ccaaaggttg ggaggtggga cctgagcagt      4500
     ggagtgaagc cacaccccac aattttttag tttatttttt tatttttaga tagggtttca      4560
     ggtagatttg caggccttga ccttactata tagttgaaga tggccttgac ctcctgaccc      4620
     ctgcctcagc catgcctggc taggacagcc aaattgttgt tgtttcaagt ctggtttcat      4680
     ttgcttccct gccgggttta ttgtgtgtac cccatttgta ctcccaataa cctgaagatt      4740
     ccatgtaact cttatgtacg cgcatgaata ctttaaatgc caaccttttc aatcattt        4798
//


spacer
spacer