spacer

EBI Dbfetch

ID   AK035512; SV 1; linear; mRNA; HTC; MUS; 2776 BP.
XX
AC   AK035512;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male urinary bladder cDNA, RIKEN full-length enriched
DE   library, clone:9530058K19 product:similar to CALCIUM-ACTIVATED CHLORIDE
DE   CHANNEL-2 [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2776
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 13162f34c54ddb236fbe6b3694b3d2f9.
DR   Ensembl-Gn; ENSMUSG00000036960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040465; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9530058K19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2776
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9530058K19"
FT                   /tissue_type="urinary bladder"
FT                   /db_xref="taxon:10090"
FT   CDS             145..2169
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="similar to CALCIUM-ACTIVATED CHLORIDE CHANNEL-2
FT                   [Homo sapiens] (SPTR|Q9Y6N2, evidence: FASTY, 70.4%ID,
FT                   84.5%length, match=2254)"
FT                   /db_xref="GOA:Q8BG22"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004727"
FT                   /db_xref="InterPro:IPR013642"
FT                   /db_xref="InterPro:IPR015394"
FT                   /db_xref="MGI:MGI:2139758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG22"
FT                   /protein_id="BAC29086.1"
FT                   /translation="MTHRDSTGPVIGLKLVTLLFTLSPELLFLGAGLKLKENGYDGLLV
FT                   AINPRVPEDLKLITNIKEMITEASFYLFNATKRRVFFRNVQILVPATWTDHNYSRVRQE
FT                   SYDKANVIVAEQSEEHGDDPYTLQHRGCGQEGRYIHFTPSFLLNDELAAGYGARGRVFV
FT                   HEWAHLRWGVFDEYNNDKPFYVNGRNEIQVTRCSSDITGVFVCEKGLCPHEDCIISKIF
FT                   REGCTFLYNSTQNATGSIMFMPSLPSVVEFCNESTHNQEAPNLQNQVCSLRSTWDVITA
FT                   SSDLNHSLPVHGVGLPAPPTFSLLQAGDRVVCLVIDVSRKMAEGDRLLRLQQAAELYLM
FT                   QVVEAHTFVGIVTFDSKGEIRASLQQIYSDDDRKLLVSYLPTAVSTDAETNICAGVKKG
FT                   FEVVEERNGRADGSVLILVTSGADEHIANCLLTSMNSGSTIHSMALGSSAARKVGELSR
FT                   LTGGLKFFIPDKFTSNGMTEAFVRISSGTGDIFQQSLQVESVCETVQPQHQLADTMTVD
FT                   SAVGNDTLFLVTWQTGGPPEIALLDPSGRKYNTGDFIINLAFRTASLKIPGTAKHGHWT
FT                   YTLNNTHHSPQALKVTVASRASSLAMSPATLEAFVERDSTYFPQPVIIYANVRKGLHPI
FT                   LNATVVATVEPEAGDPVVLQLLDGGAGADVIRNDGIYSR"
XX
SQ   Sequence 2776 BP; 745 A; 679 C; 663 G; 689 T; 0 other;
     agagggtttt caaagaaggc aactcctcat catgtattgt aagaccttct aagttccgaa        60
     agaagccagc tgcttccaca ttgatcagct gactcaaggt acccagcagg ctccccgtga       120
     ataaaccaga ggtttcactg caagatgacc cacagggaca gcacaggacc tgtcatcggg       180
     ctgaaacttg tgacccttct gttcacccta agtccagaac ttctgttcct gggagctgga       240
     ttgaagctga aagagaatgg ctatgatgga ttgcttgttg ccatcaatcc ccgggtaccc       300
     gaggatctga agctgattac aaacattaag gaaatgataa ccgaagcttc cttttacctg       360
     ttcaatgcga ccaagaggag ggtgtttttc agaaatgtac agattttagt acctgccact       420
     tggacggatc ataattacag tagagtaaga caagaatcct atgacaaggc aaatgtcata       480
     gtggctgagc agagtgagga acacggagat gatccctaca ccctacagca cagagggtgt       540
     gggcaagagg ggagatacat ccacttcacc cccagcttcc tactcaacga tgagttagcc       600
     gcaggctatg gtgcgcgagg cagagtgttt gtccacgagt gggcccatct ccgctggggt       660
     gtgttcgatg aatataacaa cgacaaaccg ttctacgtga atggacggaa tgagattcaa       720
     gtcaccaggt gttcatctga cattacaggc gtttttgtgt gtgaaaaggg cctctgcccc       780
     catgaagact gcattattag caagattttt agggaaggat gcacattcct ctacaacagc       840
     acccagaatg caactggatc aataatgttc atgccaagtt taccttctgt ggttgaattc       900
     tgtaacgaaa gtacacacaa ccaagaagct ccaaacctcc agaaccaagt gtgcagcctc       960
     agaagcactt gggacgtgat cacagcctcc tccgacctga accatagcct ccccgtgcat      1020
     ggggttggac ttccagcccc tcccacgttc tccctcttgc aggctggtga ccgagtggtc      1080
     tgcttagtga ttgatgtgtc caggaagatg gcagagggag acagactgct ccgacttcaa      1140
     caagcagccg aactgtactt gatgcaggtt gtcgaagctc acactttcgt gggcattgtc      1200
     acttttgata gcaaaggaga aatccgagcc tcgctgcagc aaatttacag tgacgatgac      1260
     cggaagctgc tggtttcata cctgccgacc gccgtgtcca ctgacgcaga aacgaacatc      1320
     tgtgcagggg ttaagaaagg ctttgaggtg gttgaggagc ggaatggaag agctgacggc      1380
     tctgtcctga tattagtgac cagtggagca gatgaacaca ttgccaactg cctgctcacc      1440
     tcgatgaaca gtggatccac cattcactcc atggccctgg gttcctctgc agccagaaaa      1500
     gtgggggaat tatcacgtct tacaggaggt ctaaagttct tcattccaga taaatttact      1560
     tctaatggaa tgactgaagc tttcgttcga atctcttctg gaacaggaga cattttccag      1620
     caaagcttac aggttgagag cgtgtgcgaa actgtgcaac cccagcacca gctggcggat      1680
     actatgactg tggatagcgc cgtgggcaat gacacacttt ttctagtcac gtggcagact      1740
     ggtggccccc ctgagattgc attattggat cctagcggaa gaaaatacaa cactggtgac      1800
     tttatcatca acctggcctt tcggacagcc agccttaaga ttccagggac agctaagcat      1860
     gggcactgga cttacacgct gaacaacacc caccattctc cccaagctct gaaagtgaca      1920
     gtggcctctc gtgcctccag cctggccatg tccccagcca ctctggaagc ctttgtggaa      1980
     agagacagca cctattttcc tcagccagtg atcatttatg cgaatgtgag gaaaggtctg      2040
     catcccattc tcaatgccac cgtggtggcg acagtggaac cagaggctgg agatcccgtt      2100
     gtactgcaac ttttggatgg cggagcaggt gcagatgtta taagaaatga tgggatttac      2160
     tccagataat attcaaatga atgctcccaa aaacttgggc cacagacctg tgaaggagag      2220
     gtggggcttc agtcgagtga gctcgggagg ctccttctcc gtgctgggag tcccagacgg      2280
     cccccaccct gacatgtttc caccgtgcaa aattactgac ctggaagcca tgaaagtgga      2340
     agacgacgtc gtcctctctt ggacggcacc tggggaagac ttcgatcagg ggcaaagtag      2400
     gcttgctgat ttgtttcata agtacctttc cacagacagt atcttcccaa cacccccccc      2460
     cccactgtgt gtgtgtagtc attttttatt gttttccata tcaacattac aaaaagcttc      2520
     actagttaaa gcaaaagcta gagacagctc aataacacaa catgaacttt acacaattac      2580
     tcatagggag gatgacatca tttttttgat tcttgctttc aaaaaaatat caagtgctcc      2640
     tggctcacat tttagcatga gtctttacat tgcaacttgg tattcagtga tttctcacac      2700
     gtatattcct tgatagtttg acttttgtgg ttattttcat tactaatctt caccaactaa      2760
     aaaccttata caaatt                                                      2776
//


spacer
spacer