spacer

EBI Dbfetch

ID   AK034828; SV 1; linear; mRNA; HTC; MUS; 2660 BP.
XX
AC   AK034828;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 12 days embryo embryonic body between diaphragm region and
DE   neck cDNA, RIKEN full-length enriched library, clone:9430043P16
DE   product:matrix metalloproteinase 16, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2660
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 62c435e2c9b3d494cea9bb64131fdfad.
DR   Ensembl-Gn; ENSMUSG00000028226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029881; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9430043P16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2660
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9430043P16"
FT                   /tissue_type="embryonic body between diaphragm region and
FT                   neck"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..486
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="matrix metalloproteinase 16 (MGD|MGI:1276107
FT                   GB|NM_019724, evidence: BLASTN, 99%, match=660)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8BSA6"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021805"
FT                   /db_xref="InterPro:IPR028697"
FT                   /db_xref="MGI:MGI:1276107"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BSA6"
FT                   /protein_id="BAC28845.1"
FT                   /translation="DVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITIWKGIPESPQGAF
FT                   VHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDKEGLSPPDDVD
FT                   IVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV"
XX
SQ   Sequence 2660 BP; 792 A; 525 C; 546 G; 797 T; 0 other;
     gatgttggca aaacctattt cttcaaaggt gacaggtatt ggagatatag tgaagaaatg        60
     aaaaccatgg accctggtta ccccaagccc atcaccatct ggaaggggat ccctgaatca       120
     cctcagggag ctttcgtcca caaagaaaat ggctttacct atttctacaa aggaaaggag       180
     tattggaaat tcaacaatca gatactcaaa gtagaacctg gttatccaag atccatcctc       240
     aaggacttta tgggctgtga tggaccaaca gaccgagata aagaaggact cagcccacca       300
     gatgatgtag acattgtcat caaactggac aacacagcca gcactgtgaa agccatagct       360
     attgtcattc cctgcatctt ggccttatgc ctccttgtat tggtttacac tgtgttccag       420
     ttcaagagga aaggaacacc ccgccacata ctgtactgta aacgctctat gcaagagtgg       480
     gtgtgatgta gggatttctt ttttctttct tttctgggag tttgtggtaa cttgagattc       540
     aagacaagag ctgttatgct gtttcctagc taggagcagg cttgtggcag cctgatggag       600
     gctgaccttc caaacctaga tggttgctgg tcctgcacat gagtggaaat ataatcatgg       660
     agaagcttcc gtgatgcaca gtatctgctg ttctccagtt ctctgtcttt ctttgtcatt       720
     cagttctagg cctttcctct gcacgctcaa tgcccagtaa aatttcagga ttaactgaag       780
     aagaggaaat atagaagaaa agtttcttct taatttttta aaaaatacat ttccttctga       840
     aatctgagcc catttctggg aaagagaaag aaagagagag aaagagagag agagagagaa       900
     agaaaaacaa aaagagcaaa tcaaaaaacc cataggtttt tgctttaagg caaaagaaga       960
     aagagtttaa aaaacaacaa aatccactat tgaactttca ggaaagtgtg aagatccaaa      1020
     acagctttgt ctccaaagaa gatagctctg tgaccactat ggatagtctc ctgcacatcg      1080
     ttttgtcagg tgggagatct ggaacacatg caggatgcta gactgttggg acagtcattt      1140
     tccaacaaac aaggggccaa aatatctgca atatagtaac agccttaata atacatgcat      1200
     ttttcgtttt ctacagctgt tctcaactat gtccacaatg tatcatcacc tccatactca      1260
     tagctgtgtt caaacaggac ctttcggttg ttttgaaata tttctgaacc ccctcctgcc      1320
     tcctgaccca gaatcattgt gatgttcttc ccagttgtgt taggcctttg tcccaggccg      1380
     tccattggtc tgtcagcaat actccgcgca aagcagagca agaagtattg tgtctctgaa      1440
     ggaaagaagg tgatggttat tttataagga tctgttactc tttaatacat cagtggaacc      1500
     ctttgagaac tatcggacca gcttacagag tcaggatgat cagtcttgca atctggtcat      1560
     ttgtagaact ggccaaaagg gaaagccatc acaggtttcg agaagttcag atttgtaaag      1620
     cataccttac aatcccatgt aactctttaa tgactgacag tactgcataa atgcttttat      1680
     aacaacgatg atgtgacttg ccaaaacttt tctggcaaat aaaaaagata ttttgttaac      1740
     agtatctcat gagagtgaaa ttttatttga ataattggtt agaaaagtct aagctttttc      1800
     ttcttcagac atattgattt tttttttatt taaaatccac tgcatgaaat ctgtttgcca      1860
     taaaatatgc agttagcatt gcttggttaa gactgaatta aaatgatgac tctgagttgc      1920
     atgaatacct accaatgcat tacctatcgc atgtcagcca tagttctcaa agggttggtg      1980
     tggcttctgg catttagcca tctatttgat cactgacaaa gccaagagac accaaagcat      2040
     cccattgttg agtgtaattt gtcctaacag cagtattgtc attctcatgt gacctgcaga      2100
     gcaggatcat atcaatattt ttttcctaga gaaaagtcag caactgacag acctctttat      2160
     tgattttaga agctgcttct tgcagtgaat ggctttgcag ccactgggct gtgaacttat      2220
     tagagatggt cagaaggaaa gcaccccatg agtcagacaa ttggctttgt gtgaaagcca      2280
     gcttttgagg ggattagctt ttgaaacaat gaacagcttg ccttgaactt gatattgatc      2340
     tgttgactgt cattaacaac aacttaaaca ctgtcttctg tgaaaatgtt ccttgaagag      2400
     ccctgttctg tgtctttgcc ctttgacctt taacttgcaa actggcacaa actgaaggaa      2460
     atctggtgtc acttctccac tggattgtga ttctctaaaa cctagtaaat gagctgtttc      2520
     cttcgagtgg agagagagtt tcagtagtgg atctgcaggt ggcgctttgc tctctacatg      2580
     cacactctga atatgcccta taggtagagg tatttttttt ctttaatttc aagcttaatt      2640
     tcattatttt agtaaaaatt                                                  2660
//


spacer
spacer