Dbfetch

ID   AK034413; SV 1; linear; mRNA; HTC; MUS; 3451 BP.
XX
AC   AK034413;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male diencephalon cDNA, RIKEN full-length enriched
DE   library, clone:9330188B09 product:hypothetical Leucine-rich repeat,
DE   outliers/Leucine-rich repeat/Leucine-rich repeat, typical subtype/Small
DE   GTPase, Ras subfamily containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3451
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ae3cef6840abfaaa28f7801477070f81.
DR   Ensembl-Gn; ENSMUSG00000036273; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022249; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022208; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022183; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022214; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021984; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022659; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021506; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021951; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022078; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022057; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022149; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022077; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022674; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021247; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021555; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000060642; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042299; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042259; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042225; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042254; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041988; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042734; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042073; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0041895; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042048; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042019; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042117; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041987; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041662; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041375; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9330188B09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3451
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9330188B09"
FT                   /tissue_type="diencephalon"
FT                   /db_xref="taxon:10090"
FT   CDS             165..1805
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Leucine-rich repeat,
FT                   outliers/Leucine-rich repeat/Leucine-rich repeat, typical
FT                   subtype/Small GTPase, Ras subfamily containing protein
FT                   (InterPro|IPR003592 InterPro|IPR001611 InterPro|IPR003591
FT                   InterPro|IPR003575, evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5S006"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020859"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032171"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="MGI:MGI:1913975"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5S006"
FT                   /protein_id="BAC28700.1"
FT                   /translation="MNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSLDMSHN
FT                   NIECLPGPAHWKSLNLRELIFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEIPPEIG
FT                   CLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDIIRFLQQ
FT                   RLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQIRGK
FT                   RRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARA
FT                   SSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLR
FT                   KTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEH
FT                   QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCL
FT                   KHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPSSLSDHRP
FT                   VIELPHCENSEIIIRLYEMPYFPMGFGQD"
XX
SQ   Sequence 3451 BP; 960 A; 793 C; 777 G; 921 T; 0 other;
     agaaacttga gcagctccta ctggaaggaa ataaaatatc cgggatttgc tctcccctga        60
     gcctgaagga actgaagatt ttaaatctta gtaaaaatca cattccatcc ctacctggag       120
     attttcttga ggcttgttca aaagtcgaga gtttcagtgc tcgcatgaat tttcttgctg       180
     caatgcctgc cttaccttct tccataacga gcttaaaatt gtctcagaac tctttcacgt       240
     gcattccaga agcgattttc agtcttccgc acttgcggtc cttggatatg agccacaaca       300
     acattgaatg tctgccggga cctgcacatt ggaagtctct gaacttaagg gaactcattt       360
     ttagcaagaa tcagatcagc accttagact ttagtgagaa cccacacgtg tggtcaagag       420
     tagagaaact gcatctctct cataataaac tgaaagagat tcctccagaa attggctgcc       480
     ttgaaaatct gacgtctctc gacgtcagtt acaacttgga actgaggtcc ttcccaaatg       540
     aaatggggaa gttgagcaag atatgggatc ttcccttgga cggactgcat ctgaattttg       600
     actttaagca cgtaggatgc aaggccaaag acatcataag gtttctacaa caacgtctga       660
     aaaaggctgt accctacaac cgaatgaagc tcatgattgt gggaaatacg gggagcggta       720
     agaccacttt actgcaacaa ctcatgaaaa tgaagaaacc agaacttggc atgcagggtg       780
     ccacagtcgg catagacgtg cgagactggt ccatccaaat acggggcaaa aggagaaagg       840
     acctggttct aaacgtgtgg gattttgcag gtcgtgagga attctacagc actcaccccc       900
     acttcatgac ccagagagcc ctctacctgg ctgtctatga tctcagcaag gggcaggcag       960
     aggtggacgc catgaagccc tggctcttca atatcaaggc tcgtgcctct tcttccccgg      1020
     tgattctggt gggcacacat ttggatgttt ctgatgagaa gcagcggaaa gcgtgcataa      1080
     gcaaaatcac gaaggaactc ctaaataagc gaggattccc caccatccgg gactaccact      1140
     ttgtgaatgc caccgaggag tcagatgcgc tggcaaagct tcggaaaacc atcataaatg      1200
     agagccttaa tttcaagatc cgagatcagc ctgtggttgg gcagctaatt ccagattgct      1260
     acgtagaact ggagaaaatc attttatcag agcggaaagc tgtgccgact gagtttcctg      1320
     tgattaaccg gaaacacctg ttacagctcg tgaacgaaca tcagctgcag ctggatgaga      1380
     acgagctccc acacgccgtt cacttcctaa atgagtcggg agttcttctg cattttcaag      1440
     accctgccct gcagctaagt gacctgtact ttgtggaacc caagtggctt tgtaaagtca      1500
     tggcacagat cttgacagtg aaggtagacg gctgtctgaa acatcctaag ggcatcattt      1560
     cccggagaga tgtggaaaaa ttcctttcaa agaagaagcg attcccgaag aactatatga      1620
     tgcaatactt taaactatta gaaaaatttc agatcgcatt gccaataggg gaagaatatc      1680
     ttctggttcc aagcagcttg tctgaccaca ggccagtgat agagctcccc cactgtgaga      1740
     actctgagat catcatccgg ctgtacgaaa tgccgtactt tcccatggga tttggtcaag      1800
     attgattaac cgattacttg aaatctcacc cttcatgctt tctggcagag agagagcact      1860
     acgccctaac aggatgtatt ggcggcaagg catctacttg aattggtctc cagaagcata      1920
     ctgtctggta ggctctgaag tcttagacaa tcgacctgag agtttcttga aaatcacagt      1980
     tccgtcttgt agaaaaggtt gtattcttct gggccgagtt gtggatcata ttgactcact      2040
     catggaagaa tggtttcccg ggttactgga gattgacatt tgtggggaag gagaaactct      2100
     gttgaagaaa tgggcattgt acagttttaa tgatggtgaa gaacatcaga agatcttgct      2160
     tgatgagttg atgaagaagg ctgaagaagg agacctgtta ataaatccag accaaccaag      2220
     gctcactatt ccaatatccc agattgctcc ggacttgatc ttggctgacc tgcctagaaa      2280
     tatcatgttg aacaatgatg agttggaatt tgaggaagca ccagagtttc tcttaggcga      2340
     tggaagtttt ggatccgttt atcgagctgc ctacgaagga gaggaagtgg ctgtgaagat      2400
     ttttaataag cacacatctc ttaggctgtt aagacaagag ttggtggtcc tttgtcacct      2460
     tcaccacccc agcctgatat ccttgctggc ggctggtatt cgtcctcgga tgttggtaat      2520
     ggagttggcc tccaaaggtt ccttggatcg cctgctgcag caggacaaag ccagcctcac      2580
     cagaaccctc cagcacagga tcgcgttgca tgtggccgac ggcctgaggt atctccactc      2640
     agccatgatt atttaccgtg acctgaagcc ccacaatgtg ctgcttttta ccctgtatcc      2700
     caatgctgcc atcattgcga agattgcgga ctacgggatc gcacagtact gctgcaggat      2760
     gggaataaag acatcagagg gcaccccaga ggctttgtcc acttatgtga cagcggtcgt      2820
     ctctgcgttc tagcacgagc ttccgggctt gacttctact gcctcaccaa ccaatcactg      2880
     ggcagtcaac ggccgctcag catacttcgc agatggagcc ttttaacttt gctgtctgac      2940
     ttcctggttt ttattaaagc cagcttaaaa ctttattgcc actcgattcc gagacagcca      3000
     caggatcctg agcccatata taatctccac tgataacttt cagggacatg actatggaag      3060
     agactctcaa caaaagaaac ccaactcttc tgttttctgc tactctctat tctccaaggt      3120
     catacacatg ctgtgggtct atttcttgtt gtaccccaaa acttctgttt gttattactt      3180
     ttattacaat tattatcact aaaggagact tctaattagc cctaaactct ggcccaagtt      3240
     tgaaaaaaaa aaaaaaaaca acagcattca tcaccacaat tgctaccaaa acttgatttg      3300
     ttttccttcc tcaaatcaat gatcttgtga agggaaaagt tctttcccac aggattttat      3360
     ctgtgttttt ctctttgttg aaatttccca ttcatggtat accttttaat gtggaaagtt      3420
     tccatgaaag aaatagaaat atgtattcat c                                     3451
//