Dbfetch

ID   AK033824; SV 1; linear; mRNA; HTC; MUS; 3693 BP.
XX
AC   AK033824;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male epididymis cDNA, RIKEN full-length enriched
DE   library, clone:9230116A03 product:membrane metallo endopeptidase, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3693
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; eee0706956ab1990fd63bdf5b8c10e5f.
DR   Ensembl-Gn; ENSMUSG00000027820; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027261; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027221; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027191; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027234; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026977; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027680; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026429; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026953; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027087; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027055; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027198; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027072; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027738; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026161; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026503; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000029400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194150; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061036; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0061054; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0060989; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060981; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060673; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061459; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060974; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0060651; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0060742; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0060733; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0060895; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060700; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061646; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060528; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059953; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9230116A03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3693
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9230116A03"
FT                   /tissue_type="epididymis"
FT                   /db_xref="taxon:10090"
FT   CDS             150..2402
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="membrane metallo endopeptidase (MGD|MGI:97004
FT                   GB|NM_008604, evidence: BLASTN, 99%, match=2253)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61391"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="MGI:MGI:97004"
FT                   /db_xref="PDB:2YVC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61391"
FT                   /protein_id="BAC28487.1"
FT                   /translation="MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   SNFDILRDELEVILKDVLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLKLLPD
FT                   IYGWPVASDNWDQTYGTSWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEQSLPIDENQLSLEMNKVMELEK
FT                   EIANATTKPEDRNDPMLLYNKMTLAKLQNNFSLEVNGKSFSWSNFTNEIMSTVNINIQN
FT                   EEEVVVYAPEYLTKLKPILTKYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKKAEEKALAIKERIGYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW"
XX
SQ   Sequence 3693 BP; 1138 A; 744 C; 779 G; 1032 T; 0 other;
     tgatagcttc ctgcagcctc cgcccaggag ttctgtttgg tgaccgagag cagcgctgcc        60
     aaattgcacc ggggttcatt tgggggctgg gaattggcca ttccgctgta cagacactgt       120
     ttttatttta aaaaacaaga ttttaggtga tgggaagatc agaaagtcag atggatataa       180
     ctgatatcaa tgctccaaag ccaaagaaga aacagcgatg gactcccctg gagatcagcc       240
     tctctgtgct tgtcttgctc ctgactatca tagcggtgac aatgatcgct ctctatgcaa       300
     cctatgatga tggcatttgc aaatcatcag actgcataaa atcagctgct cgactgattc       360
     agaatatgga tgcctctgtt gagccatgta cagacttctt caagtatgct tgtggaggct       420
     ggttgaaacg caacgtcatt cccgagacca gttcccgata cagtaatttt gacattttaa       480
     gagatgagct agaagtcatt ttgaaagatg tccttcaaga acccaaaact gaagacatag       540
     tagcagtgca gaaagcaaaa accttgtaca gatcgtgtat aaatgagtct gctattgata       600
     gcagaggcgg acaacctcta ctcaaactgt taccagatat atatgggtgg ccagtagcat       660
     cagataactg ggatcaaaca tatggcactt cttggacagc tgagaaatcc attgcacaac       720
     tgaattctaa atatgggaaa aaggtcctca ttaatttttt tgttggcact gatgataaga       780
     attctaccca gcatataatt cattttgacc agcctcgact tggcctccct tccagagact       840
     actatgagtg cactggaata tataaagagg cttgcacagc atatgtggat tttatgattt       900
     ctgtggccag actgattcgt caggaacaaa gtttgcctat tgatgaaaac cagctctctt       960
     tggaaatgaa taaagttatg gaattggaaa aagaaattgc caatgctaca actaaaccag      1020
     aagaccgaaa tgacccaatg ctgctttata acaaaatgac attggccaag ctgcagaaca      1080
     acttttccct ggaggtcaat gggaagtcat tcagctggtc aaatttcaca aatgaaatca      1140
     tgtcaactgt gaatattaat attcaaaatg aggaagaagt tgttgtctat gctccagaat      1200
     atttaaccaa acttaagcct attcttacca aatattctcc cagagatctt caaaatttaa      1260
     tgtcctggag gttcataatg gatcttgtaa gcagcctcag ccgaaactac aaggagtcca      1320
     gaaatgcttt ccgcaaggcc ctttatggga ctacatcaga aactgcaaca tggagacggt      1380
     gtgctaacta cgtcaatggg aatatggaga atgctgtggg gaggctttat gtggaagcgg      1440
     cttttgctgg agagagcaag cacgtggttg aagacttgat tgcacaaatc cgggaagttt      1500
     ttattcagac tttggatgac cttacttgga tggatgctga gacaaaaaag aaagctgaag      1560
     aaaaggcctt ggcaattaaa gaaaggattg gctatcctga tgacatcatt tccaatgaga      1620
     acaaactgaa taatgagtat cttgagttga actacaggga agatgaatac tttgagaaca      1680
     taattcaaaa tttgaaattc agccaaagca agcagctaaa gaagctccga gaaaaagtgg      1740
     acaaagatga gtggataagt ggagcagctg tagtcaatgc attttattcc tcaggccgaa      1800
     atcagatagt cttccccgct ggcattttgc agcccccatt cttcagtgct cagcaatcca      1860
     actcattgaa ctatgggggc atcggcatgg tcattggaca tgaaatcaca catggatttg      1920
     atgacaatgg aagaaatttc aataaagatg gagacctcgt tgactggtgg acgcagcagt      1980
     cggcaaataa ttttaaagac caatcccagt gtatggtata ccagtatgga aacttttcct      2040
     gggacctagc aggtggacag catctcaatg gaattaatac actaggagaa aacattgctg      2100
     ataatggagg tattggccaa gcatacagag cctatcagaa ttatgttaaa aagaatggtg      2160
     aagaaaaatt actccctgga cttgacctca atcacaaaca actatttttc ctgaactttg      2220
     cccaggtgtg gtgtgggacc taccggccag agtatgcagt caattctatt aaaacagatg      2280
     tacacagtcc tggaaatttc aggatcattg ggactttgca gaactctgcc gagtttgcag      2340
     atgcctttca ttgccgcaag aattcataca tgaatccaga aaggaaatgt cgggtttggt      2400
     gatcttcaca agatactgaa catccacggc aagatttgcc aaagccacgg aaacaggaac      2460
     tcttccctca gagaaactgg gccccggaag tttcttcagc ttcctggggg gcaattcaca      2520
     gagacgagca tgagctaaca taaatgaaat tagattatta aatctgctgt gaatgaaagg      2580
     ggagggagcc tacgatctag caaatcaatc acttcactgt gtaaataatg attactttcc      2640
     aacggtagta ctaccgttca cttctgtttc tcacacagac tgcagctttc atgttgtctg      2700
     tagagaacag tgttaacact taaagcagac tatgacttct gatcaaaagg aggacgatgc      2760
     tcagtacagc agggcaccaa agcacagatt tgcccctcag cactcacttt tgtttgcaac      2820
     attcatgctc cttccaaact ctcccaaaga actcccatac agactgtggc cttcaggctc      2880
     gtgcagtttt gaactcattt taccatacat aagttattca ttcatcccac atcaatttag      2940
     tttgaacact cttagagctt aaactagagt atctgaaacg gttcccctat ttcacccact      3000
     ttagtgatgt tgagattctt gaacccccct gcagatcttt gagcaatttc ttgctcttgc      3060
     tgcccctcag actcagtctt ttaaaggatt tgtagtaatg tataaagaat aattctatat      3120
     ttaattatta actacattta tgactgaata aaccattgct ataggtaatc attgaatatt      3180
     gaagttatat ggccaagata gttttgaaga tctgtaacat gatatacaga cgaaaatttg      3240
     agactcttta aatctgtaaa tcatattgat gaaaagcttt aagtacaaac tctgggggtg      3300
     agcattacca ttggacgggt gtcttgagat acataatagt tgtggtttac aaacagcatt      3360
     ttcaagatta agtctgtccc tagtggctaa gaaagggtct aactgtatct gtgttgctcc      3420
     atgaatgctt agccttcagg tttgtcatca gatgaaaata ttttgataat aaattgacgt      3480
     tgtgagcccc ttactaggcc tgtgtgcacg ccatgccacc tagctttaga aagcctatgt      3540
     ctgaatcgag atgggcagcc tccactgtac ctgcttcttg aattctacag ctcatggact      3600
     ctaattggat ttcctgaggc actcatatgc cttccttgtc cttctgctta ctttagtgat      3660
     tttcactatt cagtataaat tttacaaaga ttc                                   3693
//