spacer

EBI Dbfetch

ID   AK033761; SV 1; linear; mRNA; HTC; MUS; 2499 BP.
XX
AC   AK033761;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male epididymis cDNA, RIKEN full-length enriched
DE   library, clone:9230105E02 product:G PROTEIN-COUPLED RECEPTOR homolog [Homo
DE   sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2499
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2ba20995641955ceb5ebe6cb20cebd9d.
DR   Ensembl-Gn; ENSMUSG00000047678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053659; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9230105E02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2499
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9230105E02"
FT                   /tissue_type="epididymis"
FT                   /db_xref="taxon:10090"
FT   CDS             281..1267
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G PROTEIN-COUPLED RECEPTOR homolog [Homo sapiens]
FT                   (SPTR|Q96P67, evidence: FASTY, 81.6%ID, 100%length,
FT                   match=1012)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BZR0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441734"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BZR0"
FT                   /protein_id="BAC28466.1"
FT                   /translation="MTNNSTCIQPSVISTTALPVTYIFLFIIGLFGNSLAQWVFLTKIG
FT                   KKTSTHIYLANLVTANLLVCTAMPFMGIYFLRGFYWKYQSVQCRLVNFLGTLSMHVSMF
FT                   VSLLILSWIAISRYATLMKKESKQEATSCYERMFYGHVLKRFRQPNFARTMCIYIWGVV
FT                   LVIIIPVTLYYSVVEATEEGQSQCYNRQMELGARPSQIAGLIGTTFIGFSFLVVVTSYY
FT                   SLVSHLRRVRTCTSITEKDLTYRSVKRHLLIIQVLLVVCFLPYSIFKPIFYVLHQREGD
FT                   CQQLNYLIEAKNILTCLASARSSTDPIIFLLLDKTFKKTLYGLLTKS"
FT   regulatory      2471..2476
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2499
FT                   /note="putative"
XX
SQ   Sequence 2499 BP; 805 A; 447 C; 430 G; 817 T; 0 other;
     gggctgatgg ttgccctctc cagcttctca ggatcaatct ttgagtaagc ccaacttctc        60
     atcatctacg tactagacga gtgactctac tcatactgat taaggatact ggaagagtga       120
     agatcagaga actgtgagtg tgaaacagtc aatgagcata agctactcag acagacgaag       180
     gacttatcca tcgctttaag tactgttgct tttactttaa gcagaccact gtgacaacga       240
     gaaaagctcc tgtgacaaaa atcaagaaaa tctaatataa atgactaata actcgacatg       300
     cattcaacca tccgtgattt ctaccacagc tttaccggtc acttacatct ttttgtttat       360
     tattggtctc tttggaaact cacttgctca gtgggtattt ttaacaaaaa taggtaagaa       420
     aacatcaaca catatctact tggcaaatct tgtgactgca aacttacttg tgtgcactgc       480
     tatgcctttc atgggtatat atttcttgag aggtttttat tggaaatatc aatctgtaca       540
     atgcagactg gtcaattttt tgggaactct ttctatgcat gtaagtatgt ttgtcagcct       600
     cttaatttta agctggattg ccataagccg ctatgctacc ttaatgaaaa aggagtccaa       660
     gcaagaggcc acctcatgct acgagagaat gttttatggt cacgtactga aaagatttcg       720
     ccagcccaac tttgccagaa caatgtgtat ttacatatgg ggagttgtgc ttgtcataat       780
     tattccagtt accctatact actcagtagt cgaggctaca gaagaaggac agagccagtg       840
     ctacaatcgg cagatggaac tgggagccag accttctcag attgcgggtc tcattggaac       900
     cacatttatt ggattctcct ttttagtagt agtgacatca tactattctc ttgtcagcca       960
     tctgcgaaga gtaaggacct gtacctccat taccgagaaa gatttgacct acagatctgt      1020
     gaaaagacac cttttgatca tccaggtcct cctagtagtt tgctttcttc catatagtat      1080
     ttttaaaccc attttttatg ttctgcacca gagagaagga gactgtcagc agctgaatta      1140
     tttaatagaa gcaaaaaaca tcctcacttg tcttgcatca gccagaagta gtacagaccc      1200
     cattatattt cttttattag ataaaacatt caagaagaca ctatatggtc tccttacaaa      1260
     atcttaattc actgcacatt ctaacatatg gttgactttt ggatagaaaa caccacaaaa      1320
     taggaaaaaa aatgcatgtg actcttagtg acattaacgg gcaccaagaa aacctctatg      1380
     gtttttttaa aaaaagatat atgcataaaa ttggacttac agttctactt atattgaaag      1440
     accagatggc agagactttc agagacaagt caagcatacc aaagggattc tactgtgtgt      1500
     gaagtcagac tttttgtttt gttttgtttt gttttcagtc agttgtggat attctgttca      1560
     aaacacaata ttttatgact ataggatgaa gaaccaaaaa ggcttatggg tttgcctgct      1620
     ttctaaccta atgcaagtac ccatctatgg tcagatttta tattgttggt aactttaaaa      1680
     aataatttta aaatgtaagt actggaaaag tcgagcagta agaaatgttt ttatttaaat      1740
     cccatctaac tgcatgaata atgcagtgtg aagtcaattt ggtattattt ggctcatttt      1800
     actgggaaag gcaatattca atgattctaa tatttaatac atagatttta cttacacaca      1860
     tttggattac acttgtcaaa ataaaaaaat ataaaattat atgtccatct atatgctatt      1920
     ttatatattt ccaatataaa taatggtgct atcaatgata gtacctgcca tctatttaat      1980
     taatttttgt aaactaaaca aatgaagtat aaagaattgt aaccatgttg gataaaaggc      2040
     tggcctctgg attcaaactg tctgggtatt atactgtctc catctcttat ttagatggag      2100
     aattttgggc aaactactta ctctctttac ataatagttt ctttaatcgt ggaacagaaa      2160
     atatgacctg attcatatca ctattattaa atcagatact gttcctactg tgagctacca      2220
     gcacttgcta tgtgctaggc cctctgtgta tatgtttcat gattataatt ttaatcatca      2280
     caaccacaaa gcatgttaat gtacttactg atgaaaaaac ccagatatga agtgaagtgg      2340
     ttatcccaat tcctccagta tttaagtata tttaagaagc aatcatttct tagtgataat      2400
     ttctttcatg taatcttgcc agtaacgaaa agagtgatta tattctgtat tgtatacatt      2460
     atgattaaaa aataaaaaaa gtgttcttca aatgatcat                             2499
//


spacer
spacer