Dbfetch

ID   AK033734; SV 1; linear; mRNA; HTC; MUS; 3244 BP.
XX
AC   AK033734;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male cecum cDNA, RIKEN full-length enriched library,
DE   clone:9130403O08 product:platelet-derived growth factor, C polypeptide,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3244
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f0f717967c7af4285fcc18d6ac7d5ac0.
DR   Ensembl-Gn; ENSMUSG00000028019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029652; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9130403O08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3244
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9130403O08"
FT                   /tissue_type="cecum"
FT                   /db_xref="taxon:10090"
FT   CDS             751..1788
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="platelet-derived growth factor, C polypeptide
FT                   (MGD|MGI:1859631 GB|NM_019971, evidence: BLASTN, 99%,
FT                   match=2690)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CI19"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="InterPro:IPR029817"
FT                   /db_xref="MGI:MGI:1859631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CI19"
FT                   /protein_id="BAC28455.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDIC
FT                   KYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
FT   regulatory      3216..3221
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3244
FT                   /note="putative"
XX
SQ   Sequence 3244 BP; 821 A; 810 C; 763 G; 850 T; 0 other;
     ggccacctct cctcagccct gcgtcctgcc ctgccttagg gcaggcatcc gagcgctcgc        60
     gactccgagc cgcccaagct ctcccggctt cccgcagcac ttcgccggta cccgagggaa       120
     cttcggtggc caccgactgc agcaaggagg aggctccgcg gtggatccgg gccagtcccg       180
     agtcgtcccc gcggcctctc tgcccgcccg ggacccgcgc ggcactcgca gggcacggtc       240
     ccctcccccc aggtgggggt ggggcgccgc ctgccgcccc gatcagcagc tttgtcattg       300
     atcccaaggt gctcgcctcg ctgccgacct ggcttccagt ctggcttggc gggaccccga       360
     gtcctcgcct gtgtcctgtc ccccaaactg acaggtgctc cctgcgagtc gccacgactc       420
     atcgccgctc ccccgcgtcc ccaccccttc tttcctccct cgcctacccc caccccccgc       480
     acttcggcac agctcaggat ttgtttaaac cttgggaaac tggttcaggt ccaggttttg       540
     ctttgatcct tttcaaaaac tggagacaca gaagagggct ctaggaaaaa cttttggatg       600
     ggattatgtg gaaactaccc tgcgattctc tgctgccaga gccggccagg cgcttccacc       660
     gcagcgcagc ctttccccgg ctgggctgag ccttggagtc gtcgcttccc cagtgcccgc       720
     cgcgagtgag ccctcgcccc agtcagccaa atgctcctcc tcggcctcct cctgctgaca       780
     tctgccctgg ccggccaaag aacggggact cgggctgagt ccaacctgag cagcaagttg       840
     cagctctcca gcgacaagga acagaacgga gtgcaagatc cccggcatga gagagttgtc       900
     actatatctg gtaatgggag catccacagc ccgaagtttc ctcatacata cccaagaaat       960
     atggtgctgg tgtggagatt agttgcagta gatgaaaatg tgcggatcca gctgacattt      1020
     gatgagagat ttgggctgga agatccagaa gacgatatat gcaagtatga ttttgtagaa      1080
     gttgaggagc ccagtgatgg aagtgtttta ggacgctggt gtggttctgg gactgtgcca      1140
     ggaaagcaga cttctaaagg aaatcatatc aggataagat ttgtatctga tgagtatttt      1200
     ccatctgaac ccggattctg catccactac agtattatca tgccacaagt cacagaaacc      1260
     acgagtcctt cggtgttgcc cccttcatct ttgtcattgg acctgctcaa caatgctgtg      1320
     actgccttca gtaccttgga agagctgatt cggtacctag agccagatcg atggcaggtg      1380
     gacttggaca gcctctacaa gccaacatgg cagcttttgg gcaaggcttt cctgtatggg      1440
     aaaaaaagca aagtggtgaa tctgaatctc ctcaaggaag aggtaaaact ctacagctgc      1500
     acaccccgga acttctcagt gtccatacgg gaagagctaa agaggacaga taccatattc      1560
     tggccaggtt gtctcctggt caagcgctgt ggaggaaatt gtgcctgttg tctccataat      1620
     tgcaatgaat gtcagtgtgt cccacgtaaa gttacaaaaa agtaccatga ggtccttcag      1680
     ttgagaccaa aaactggagt caagggattg cataagtcac tcactgatgt ggctctggaa      1740
     caccacgagg aatgtgactg tgtgtgtaga ggaaacgcag gagggtaact gcagccttcg      1800
     tagcagcaca cgtgagcact ggcattctgt gtacccccac aagcaacctt catccccacc      1860
     agcgttggcc gcagggctct cagctgctga tgctggctat ggtaaagatc ttactcgtct      1920
     ccaaccaaat tctcagttgt ttgcttcaat agccttcccc tgcaggactt caagtgtctt      1980
     ctaaaagacc agaggcacca agaggagtca atcacaaagc actgccttct agaggaagcc      2040
     cagacaatgg tcttctgacc acagaaacaa atgaaatgaa tgtagatcgc tagcaaactc      2100
     tggagtgaca gcatttcttt tccactgaca gaatggtgta gcttagttgt cttgatatgg      2160
     gcaagtgatg tcagcacaag aaaatggtga aaaacacaca cttgattgtg aacaatgcac      2220
     aaatacttgg atttctccaa cctgtttgca tagatagaca gatgctctgt tttctacaaa      2280
     ctcaaagctc ttacagagca gctatgttaa taggaattaa atgtgccatg ctgaaaggaa      2340
     agactgaagt tttcaatgct tggcaacttc tccgcaattt ggaggaaagg tgcggtcatg      2400
     gtttggagaa agcacacctg cacacaggag tggccttccc ttcccttccc tctgaggtgg      2460
     cttcctgtgt ttcattgtgt atatttttat attctccttt tgacattata actgttggct      2520
     ttcctaatct tgttaaatat ttctattttt accaaaggta tttaatattc ttttttatga      2580
     caacctagag caattatttt tagcgtgata attttttttt ctaaacaaaa ttgttatagc      2640
     cagaagaaca aagatgattg atataaaaat cttgttgctc tgacaaaaac atatgtattt      2700
     cttccttgta tggtgctaga gcttagcgtc atctgcattt gaaaagatgg aatggggaag      2760
     tttttagaat tggtaggtcg cagggacagt ttgataacaa ctgtactatc atcaattccc      2820
     aattctgttc ttagagctac gaacagaaca gagcttgagt aaatatggag ccattgctaa      2880
     cctacccctt tctatgggaa ataggagtat agctcagaga agcacgtccc cagaaacctc      2940
     gaccatttct aggcacagtg ttctgggcta tgctgcgctg tatggacata tcctatttat      3000
     ttcaatacta gggttttatt acctttaaac tctgctccat acacttgtat taatacatgg      3060
     atatttttat gtacagaagt atatcattta aggagttcac ttattatact ctttggcaat      3120
     tgcaaagaaa atcaacataa tacattgctt gtaaatgctt aatctgtgcc caagttttgt      3180
     ggtgactatt tgaattaaaa tgtattgaat catcaaataa aataatctgg ctattttggg      3240
     gact                                                                   3244
//