spacer

EBI Dbfetch

ID   AK033713; SV 1; linear; mRNA; HTC; MUS; 2073 BP.
XX
AC   AK033713;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male cecum cDNA, RIKEN full-length enriched library,
DE   clone:9130230B07 product:5-HYDROXYTRYPTAMINE 2B RECEPTOR, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2073
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2f1b99d9448997aec0cb38e7a03560fb.
DR   Ensembl-Gn; ENSMUSG00000026228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027431; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9130230B07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2073
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9130230B07"
FT                   /tissue_type="cecum"
FT                   /db_xref="taxon:10090"
FT   CDS             328..1767
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5-HYDROXYTRYPTAMINE 2B RECEPTOR (SPTR|Q9QWS2,
FT                   evidence: FASTY, 99.8%ID, 100%length, match=1437)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q02152"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000482"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109323"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02152"
FT                   /protein_id="BAC28441.1"
FT                   /translation="MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQT
FT                   VEGQGHTVHWAALLILAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGL
FT                   FVMPIALLTIMFEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQAN
FT                   QCNSRATAFIKITVVWLISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSL
FT                   AAFFAPLTIMVVTYFLTIHTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKVA
FT                   MLDGSHRDKILPNSSDETLMRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFF
FT                   ITNLTLALCDSCNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYR
FT                   ATKSVKALRKFSSTLCFGNSMVENSKFFTKHGIRNGINPAMYQSPMRLRSSTIQSSSII
FT                   LLDTLLTENDGDKAEEQVSYI"
XX
SQ   Sequence 2073 BP; 593 A; 481 C; 450 G; 549 T; 0 other;
     gagagcaagt cagtggggga ggatctgcca ggagagggag tccaactgaa cagacacagg        60
     acggctggct taggaagcca cagaagacaa gcgtcttctg gaatctaagc ctctagaaaa       120
     tctaaaatgt ggatgtctta cctgcaaaca cggacagacg tgtacacagt cccatcttcg       180
     agagcctgaa tctttttaga aggaagaagt caccttggct gtgagtgtct ggtaggtttg       240
     ctaaatgctt tgctaaagca gatgacttgc ttagctactg accatgctga ccactgtctg       300
     gaactggact gagtcaccaa aaggcgaatg gcttcatctt ataaaatgtc tgaacaaagc       360
     acaacttctg agcacatttt acagaagaca tgtgatcacc tgatcctgac taaccgttct       420
     ggattagaga cagactcagt agcagaggaa atgaagcaga ctgtggaggg acaggggcat       480
     acagtgcact gggcagctct cctgatactc gcggtgataa tacccaccat tggtgggaac       540
     atccttgtga ttctggctgt tgcactggag aaaaggctgc agtacgctac caactacttt       600
     ttaatgtcct tggcgatagc agatttgctg gttggattgt ttgtgatgcc gattgccctc       660
     ttgacaatca tgtttgaggc tatatggccc ctcccactgg ccctgtgtcc tgcctggtta       720
     ttcctcgatg ttctcttttc aactgcctcc atcatgcatc tctgtgccat ttccctggac       780
     cgctatatag ccatcaaaaa gccaattcag gccaatcagt gcaactcccg ggctactgca       840
     ttcatcaaga ttacagtggt atggttaatt tcaataggca tcgccatccc agtccctatt       900
     aaaggaatcg agactgatgt gattaatcca cacaatgtca cctgtgagct gacaaaggac       960
     cgctttggca gttttatggt ctttgggtca ctggctgctt tcttcgcacc tctcaccatc      1020
     atggtagtca cttactttct caccattcac actttacaga agaaagctta cttggtcaaa      1080
     aataagccac ctcaacgcct aacacggtgg actgtgccca cagttttcct aagggaagac      1140
     tcatcctttt catcaccaga aaaggtggca atgctggatg ggtctcacag ggataaaatt      1200
     ctacctaact caagtgatga gacacttatg cgaagaatgt cctcagttgg aaaaagatca      1260
     gcccaaacca tttctaatga gcagagagcc tcgaaggccc ttggagtcgt gtttttcctt      1320
     tttctgctta tgtggtgccc cttttttatt acaaatctaa ctttagctct gtgtgattcc      1380
     tgcaatcaga ccactctcaa aacactcctg gagatatttg tgtggatagg ctacgtttcc      1440
     tcgggggtga atcctctgat ctatacactc ttcaataaga catttcggga agcatttggc      1500
     aggtacatca cctgcaatta ccgagccaca aagtcagtaa aagcacttag gaagttttcc      1560
     agtacacttt gttttgggaa ttcaatggta gaaaactcta aatttttcac aaaacatgga      1620
     attcgaaatg ggatcaaccc tgccatgtac cagagcccaa tgaggctccg aagttcaacc      1680
     attcagtcct catcaatcat cctcctcgat acccttctca ctgaaaacga tggcgacaaa      1740
     gcggaagagc aggtcagcta catatagcag aacgggccgc cctcatctga gagaggtgat      1800
     gagcaggacg cacgcgcaac atggaaaggt acagagtgaa tgaaaacccc accctctcct      1860
     gagtgaagta ccaaggctgt ccagcttcct tatctaaaca aactcaagca tggctaaagt      1920
     agatctgatg gcttcaaaca aacgcaatct ctactctggt tttcaaatac aattaaataa      1980
     gttgataaat ttcagtcttt taaaaaaaaa gaatgtcaac aaatttttaa gtttctaatg      2040
     tgtgtaaagt tgtgttaaga aagaaataaa atg                                   2073
//


spacer
spacer