spacer

EBI Dbfetch

ID   AK033286; SV 1; linear; mRNA; HTC; MUS; 2442 BP.
XX
AC   AK033286;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 15 days embryo male testis cDNA, RIKEN full-length enriched
DE   library, clone:8030486G21 product:hypothetical Leucine-rich repeat
DE   containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2442
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5dbdf390725fcc298eb87bc7015c6193.
DR   Ensembl-Gn; ENSMUSG00000045287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102514; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=8030486G21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2442
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="15 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="8030486G21"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             288..1625
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Leucine-rich repeat containing protein
FT                   (InterPro|IPR001611, evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8K0S5"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:2661375"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K0S5"
FT                   /protein_id="BAC28223.1"
FT                   /translation="MLRKGCCVELLLLLLAGELPLGGGCPRDCVCYPAPMTVSCQAHNF
FT                   AAIPEGIPEDSERIFLQNNRITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEE
FT                   LDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEY
FT                   LQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQWVHHKAFHDLHR
FT                   LTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVP
FT                   CATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRAARKEHHPSHGASRDKG
FT                   HPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKELTELQDYAPDYQHKFSFDIMPT
FT                   ARPKRKGKCARRTPIRAPSGVQQASSGTALGAPLLAWILGLAVTLR"
XX
SQ   Sequence 2442 BP; 517 A; 760 C; 651 G; 514 T; 0 other;
     gagaatcagg ccgccggctc ggcggagcaa gccactcgcc cggggctgag cgagcgcacc        60
     gcgttggttg gcagcgccgc ggttgctagc aggcgccggt gccctgagca ccgggtttgg       120
     gctcaccatg cccctgcggg accgggccgc cgggcacaag cggattcccg gcttgccccc       180
     gcctcgacgc gctcggatta gctgcagctg gcgcccaggg atttgaatct ggaccccagg       240
     agggagcgcg cctaggccga cctcggagcg gcggccccgc ggccaacatg cttcgcaaag       300
     ggtgctgtgt ggaattgctg ctgttgctgc tcgctggaga gctacctctg ggtggtggtt       360
     gtcctcgaga ctgtgtgtgc taccctgcgc ccatgactgt cagctgccag gcacacaact       420
     ttgctgccat cccggagggc atcccagagg acagtgagcg catcttcctg cagaacaatc       480
     gcatcacctt cctccagcag ggccacttca gccccgccat ggtcaccctc tggatctact       540
     ccaacaacat cactttcatt gctcccaaca ccttcgaggg ctttgtgcat ctggaggagc       600
     tagaccttgg agacaaccga cagctgcgaa cgctggcacc cgagaccttc caaggcctgg       660
     tgaagcttca cgccctctac ctctataagt gtggactgag cgccctgccc gcaggcatct       720
     ttggtggcct gcacagcctg cagtatctct acttgcagga caaccatatc gagtacctcc       780
     aagatgacat ctttgtggac ctggtcaatc tcagtcactt gtttctccat ggtaacaagc       840
     tatggagcct gggccaaggc atcttccggg gcctggtgaa cctggaccgg ttgctgctgc       900
     atgagaacca gctacagtgg gttcaccaca aggctttcca tgacctccac aggctaacca       960
     ccctctttct cttcaacaac agcctcactg agctgcaggg tgactgtctg gcccccctgg      1020
     tggccttgga gttccttcgc ctcaatggga atgcttggga ctgtggctgc cgggcacgtt      1080
     ccctgtggga atggctgcga aggttccgtg gctctagctc tgctgtcccc tgcgcgaccc      1140
     ccgagctgcg gcaaggccag gatctgaagc tgctgagggt ggaggacttc cggaactgca      1200
     caggaccagt gtctcctcac cagatcaagt ctcacacgct taccacctct gacagggctg      1260
     cccgcaagga gcaccatccg tcccatgggg cctccaggga caaaggccac ccacatggcc      1320
     atccgcctgg ctccaggtca ggttacaaga aggcaggcaa gaactgcacc agccacagga      1380
     accggaacca gatctctaag gtgagctctg ggaaagagct taccgaactg caggactatg      1440
     cccccgacta tcagcacaag ttcagctttg acatcatgcc caccgcacga cccaagagga      1500
     agggcaagtg tgctcgcagg acccccatcc gtgcccccag tggggtgcag caggcatcct      1560
     caggcacggc ccttggggcc ccactcctgg cctggatact ggggctggca gtcactctcc      1620
     gctgaggacc cagggctccg tcacccagca ctgccacatg tccagcaagg aacagaattt      1680
     ttttcttctt ttctttcttt ctttcttttt tttttcctaa gtggaagatc tgctgggttt      1740
     caggaaaagg ctgctgaagc cttcagccac cgtctggacc cttcctggtg gattataagc      1800
     ccaaaatgta cagccgtaga cgggaagggt atcacgtctc actcggctgt cctgaccgag      1860
     cgcctctgga ccgtatccac tccagcacag tggtcaaagg cacgcaaagt gagtcattag      1920
     tggtgtcggg acatgcgccc cttgaagaag ctgggctctg cggaagcctg gtcatttgga      1980
     gagaagggct gaaggaccct gctggttttg gaaggagcag gactcagaac aaggctctcc      2040
     cagagccagc tggggcaacc agcaatctca gagcactctt ggctcttgtc tgagatcact      2100
     tagttaacct gccctgtcca accctatgcc accctcagtc cctatccatg ggggtaatgc      2160
     ctctcattcc tgacgtctca ggcagccccc ggcagacctg ctggggtcca agaaccaatc      2220
     accaaaggag agatcgccag tggatgacat ttagaactgt actcgcaatg agagtcacac      2280
     agaaggtgca gttttatacc tatgtccact tatatatatc ctcactctgc ccacacaccc      2340
     acataatata tatatatata taaatatata aatgcacagg tcccccaacc cactccttac      2400
     caaactgtat gtcttatcat gtttataaac tatacgggaa cc                         2442
//


spacer
spacer