Dbfetch

ID   AK032732; SV 1; linear; mRNA; HTC; MUS; 2374 BP.
XX
AC   AK032732;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 12 days embryo male wolffian duct includes surrounding region
DE   cDNA, RIKEN full-length enriched library, clone:6720422G09 product:solute
DE   carrier family 39 (iron-regulated transporter), member 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2374
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 3575f3b8e0fc577c65551734dc3ea183.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0015996; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0015980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0015935; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015934; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015767; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016387; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015349; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015739; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015840; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015842; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0015910; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015133; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015410; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0019671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0019628; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019620; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019449; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0018956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0019403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0019517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0019523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0019605; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019493; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018713; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019044; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6720422G09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2374
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6720422G09"
FT                   /tissue_type="wolffian duct includes surrounding region"
FT                   /db_xref="taxon:10090"
FT   CDS             121..1038
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 39 (iron-regulated
FT                   transporter), member 1 (MGD|MGI:1315204 GB|NM_016917,
FT                   evidence: BLASTN, 98%, match=2360)"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="BAC28001.1"
FT                   /translation="MGEKDSNIRELECEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLA
FT                   GMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASAITGIMGTVAFTWLRRKCGL
FT                   VRTGLFSGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFVNVEPVSPTTKIPETV
FT                   FTTEMHMSNMSNVHEMSTKPIPIVSVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESE
FT                   RGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHLMYFRFAQKTLG
FT                   NQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 2374 BP; 662 A; 473 C; 488 G; 751 T; 0 other;
     gtttaccaga agacccctgc tctggctgta aaagctgctc tcaaggtaga ggagtcagaa        60
     ctgaagcagc tgacctcacc taaagatact gagccaaaac ctttggaggg aactcatcta       120
     atgggtgaga aagactccaa catccgtgaa cttgaatgtg aacaagagcc cacctgtgcc       180
     tcccagatgg cagagccctt ccgcactttc cgagatggat gggtctccta ctataaccag       240
     ccagtgtttc tggctggcat gggtctggct ttcctctata tgacagtcct gggctttgac       300
     tgtatcacta cagggtacgc ctacactcag gggctgagtg gatccatcct tagtattttg       360
     atgggagcat cagcaataac tggaataatg ggaactgtgg ccttcacctg gctacgtcga       420
     aaatgtggcc ttgttcggac tggtctattc tcaggactag cccagctttc ctgtttaatc       480
     ttgtgtgtga tctccgtatt catgcctgga agccccttgg acctgtctgt ttctccattt       540
     gaagatatcc gttctaggtt tgtgaatgtg gagccagtgt ccccaactac caaaatacct       600
     gagaccgtct ttacaacaga aatgcatatg tccaacatgt ctaatgtcca tgagatgagt       660
     actaaaccca tccccatagt ctctgtcagc ctgctgtttg caggagtcat tgctgctaga       720
     atcggtcttt ggtcctttga tttgacggtg acacagttgc tgcaagaaaa tgtaattgaa       780
     tctgaaagag gcattatcaa tggtgtgcag aactccatga actaccttct tgaccttctg       840
     catttcatca tggtcatctt ggccccaaat cctgaagctt ttggcttgct ggtattgatt       900
     tcagtctcct ttgtggcaat gggacatctt atgtatttcc gatttgccca gaagactctg       960
     ggcaaccaga tttttgtttg tggtcctgat gaaaaagaag ttacagatga aaatcaaccg      1020
     aatacatctg ttgtataaaa atagtttagc tgtggcccct gttactagat tgtggagagc      1080
     atgtgtgctt attttgtact gcagaatccc aataaatgcc tgcatttctc tctggtttta      1140
     ccacatctgt gccttaaggg ctaggagcac taactaacca tcgccagcaa agatggttat      1200
     ttctccttac atgtaaacat tggaaaatag gaagagggag aggcagtcag cgtgtgtata      1260
     ggaagggttt aatggtaaaa tgaacttccc ttactcttat gagtatatta aattttaaag      1320
     agtggttgtc aggtgagtaa aattattcct tagcagatat ttattatcta ctggaatgat      1380
     aaatcaattc gccctaaaac tcactcttgt aaaactctgc tccacttcct ttttttaaga      1440
     tcagtgatat ttttctcagt tacattacag aaacaagttt ttcctccatg tatgaaggtt      1500
     atagttagat aatgaatgtt atccttatta atcccattga acttaaggaa tttattgtat      1560
     gtggaggatg aaatgtgtaa ctagacttgt ccaaaaggtt catggaataa cttttgcatt      1620
     ttgaccatca gaaagggcaa aatattacag taatgtgtgt atggtggctc ttcataaaat      1680
     gactctcaaa atctgcagaa agaagaaaag ttgtaggttt ctagtgtggt acagaaggac      1740
     ttaaagcttg ttattagtgt gattgtagaa actggaagct aagggtgagg acctcatgta      1800
     accagagtca ctgtcatcag ccatcactaa ctattttggt aaatgagaga actgacctgg      1860
     caccttacaa gcagaaaagc ggcccacact aagaaaggac tgcaaatcag tgagtctgta      1920
     tagaacattt taccttcact gacttgggcc gatgtgtttg tcatctctgt gtttttctag      1980
     agcaagaata gtcacaaaag ttcccctttc aatatccctg agaagaataa agaaaaaact      2040
     gtttgtaaat atttttttaa aactgttctg caagtctttt tgtaacatgc agtaccaaca      2100
     tgggacattg ccttaacttt tgatgcactt tcatggagac tgactgccat gcattgctgt      2160
     gagcactttc tttgtcgttc agtttaatct tttccttcac ctttattaca gtatgacata      2220
     atgatctact atgttgtcaa agcttcataa aatatttcta tataaaatgt ttgtagaatc      2280
     ttcatttgcc tttactgagt tgtgttctcc caattattgt tacttatttc aaaattagca      2340
     tataaaaagt gtttgatatc atcatcgccc ttcg                                  2374
//